close all open/close all

CDS information : Alip_00180


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction61,779 / 57,097 / - [in whole cluster]
61,779 / 57,097 / - [in contig]
Locationcomplement(57097..61779) [in whole cluster]
complement(57097..61779) [in contig]
TypeCDS
Length4,683 bp (1,560 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)LipX3
Gene
Gene (GenBank)lipX3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [LipX3]
MVGHRPSDWHVLDLDKDPTPGDPQRVRTLAKTLHDFADDVSEALRLVKGMAGESTLAEWA
GKSAAVFKEEFDGVPKNLRKLEKSYGMCGDALADFWPKLERAQALADRALVKAREARQDL
SSAQSKLSSADSWVTRASKEADKYKDDPTGSKSDADKPDEAKVRAATRDVQHAKTAQTNA
QSAVDSAQGALDAAKKMAEDARKMRDDAAREAKNKIDEASDAGIQNRSWWEEVGDWVSDN
WDSIVAVCKVVVAVVGIIAMVIGGPILAAIVVVAALVVLADTLYKYSKGQASLWDVGFAA
LDCIPGMKGLTTLGGLAKGMKGMATAMRGGLKTLRSGAKDLLAKAKPYKGRCRGGDPIDM
VSGEMLMEQVDLELGGLLPLVVRRTHVSTYRWGRCFGPSWASTLDQRLEIDDQGVVFASE
DGMLLAYPIPAPGTATLPLEGPRRPLTWNGDSEGTITVHDDETGRTHHFAPGVRREGDDA
PAYTLPLTAMSDRNGHRIDFLYDEAGVVAEMRHSGGYRVAVATEDGRVTSLSVLSSPEDG
YGVEADSPWAVVRRYGYDAEGNLRAVSDGQGRDFRLTYDAESRITSWTDRNGGWYRYTYD
ERHRVTAGRGADGFLDCSLTYDDAARVNTYRNSLGRTTTYRFDERLQLVQVTDPLGASTH
REWDENGRLVAWTDPLGRTTRQVFDAAGHLIEVVRPDLSSVRAEYDEAGRTRRLTDPDGS
FWSYTYDDRGNRLTVTDPSGATTRHRYDALGRPLSVTDALGHTRHIETDPAGLPLALTDP
EGRTTRARRDSFGRVTAVTDPTGATDRFGWTVEGLASWRSFPDGATEAWSWDGEGNLASH
TARNGAVTTYEFTHFHQPTSRTTPDGRRYTFAYDTELNLTGVHNADGRTWEYAYDDANRL
MRETDFNGRTLTYTHDAAGQRTSWTNGAGQTTDVTVDLLGRPRQYRTADEVTTYEYDSAG
SLLRAANRDTTVERTYDSMGRTLTETVNGRTTTYTYDALGRRISRRTPSSITSTWTYEAT
GHPQTLSGTGSRLRFDYDTAHREIRRTLGAEAVLHQSWDGSGRLTGQSVTTPGRAGGDAG
GELLQHRTYEYDPDGALREIDELLGESRRFDVDPVGRLTAVRTADREERYGYDRAGNLVT
SSPYDGTAEPRPHHVDGTRLHRAGRTTYAYDGQGRLIRKTVRLLSGGRRTSQYGWSAEDR
LVRTVAPDGSEWRYTYDPDGRRVGKQRLGTGGDVLEETTFSWDGTRLAEQIETDGTVTTW
DYAPGSYRPVAQTVSGGRERPAVNRGGSDPGDTDARFYAIVTDLVGTPTELVSADGRIVW
HRRFTAWGQPTGTPTPGPEADCPLRFPGQYADAETGWNYNYFRYYDPETARYVSADPLGL
APDPNDYAYVTNPLLLLDPLGLIRIRGQRGRWERDPNSPGVQAHNRDTEYPGSYRQSTHD
AMTAAWTDEGIAQGGTPMRPTGQLDPQGRQIMERIPRSELTWRNSAGEIIPSNQLTYEHL
TPVVDHWNQTGYRSDRATRNDFYNDPDNMEPMTRSENSRGGALMDATYRQDVDPTLYSCS
selected fasta
>hypothetical protein [LipX3]
ATGGTGGGCCACAGGCCGAGTGACTGGCATGTCCTGGACCTGGACAAGGACCCGACCCCG
GGGGATCCGCAGCGGGTGCGGACGCTCGCGAAGACGTTGCACGACTTCGCCGACGACGTC
TCGGAGGCGTTGCGTCTGGTGAAGGGCATGGCCGGCGAGTCCACGCTGGCCGAGTGGGCG
GGGAAGTCGGCGGCGGTCTTCAAGGAGGAGTTCGACGGGGTTCCCAAGAACCTCAGGAAG
CTGGAGAAGTCGTACGGGATGTGCGGTGACGCGCTCGCGGACTTCTGGCCGAAGCTGGAG
CGGGCGCAGGCGCTGGCGGACCGGGCGCTCGTCAAGGCGCGGGAGGCGCGCCAGGACCTG
TCCTCGGCGCAGTCGAAGCTGTCCTCGGCGGATTCGTGGGTGACGCGGGCGTCGAAGGAG
GCGGACAAGTACAAGGACGATCCGACGGGCAGCAAGTCGGACGCGGACAAGCCGGACGAG
GCGAAGGTCCGTGCCGCCACTCGGGACGTCCAGCACGCCAAGACCGCACAGACCAACGCC
CAGTCGGCGGTCGACTCGGCGCAGGGGGCGCTGGACGCGGCGAAGAAGATGGCCGAGGAC
GCGCGCAAGATGCGTGACGACGCGGCGCGGGAGGCCAAGAACAAGATCGACGAGGCGTCC
GACGCCGGTATCCAGAACCGGTCGTGGTGGGAGGAGGTCGGGGACTGGGTCTCCGACAAC
TGGGACTCGATCGTCGCGGTCTGCAAGGTCGTCGTCGCCGTCGTCGGCATCATCGCGATG
GTCATCGGCGGCCCGATCCTCGCCGCGATCGTCGTCGTGGCCGCTCTCGTCGTCCTCGCG
GACACGCTCTACAAATACTCCAAGGGCCAAGCATCCCTATGGGACGTCGGGTTCGCCGCA
CTCGACTGCATACCCGGCATGAAGGGGCTCACCACTCTCGGCGGACTCGCCAAGGGCATG
AAGGGGATGGCCACCGCCATGCGGGGTGGTCTGAAGACGCTGCGTTCCGGTGCCAAGGAC
CTGCTCGCGAAGGCCAAGCCCTACAAGGGCCGGTGCCGGGGCGGCGACCCGATCGACATG
GTGTCCGGCGAGATGCTCATGGAGCAGGTGGACCTGGAACTCGGCGGGCTCCTGCCGCTG
GTCGTCCGGCGCACCCACGTCTCGACCTACCGCTGGGGGCGTTGCTTCGGGCCGAGCTGG
GCCTCGACGCTGGACCAGCGCCTGGAGATCGACGACCAGGGCGTGGTGTTCGCCAGTGAG
GACGGCATGCTCCTGGCCTATCCGATCCCCGCGCCCGGCACCGCCACCCTGCCCCTCGAG
GGCCCTCGACGGCCGTTGACGTGGAACGGTGACAGTGAAGGCACGATCACCGTCCACGAC
GACGAGACCGGACGGACGCACCACTTCGCCCCCGGCGTACGGCGCGAGGGCGACGACGCC
CCCGCCTACACCCTCCCTCTCACCGCGATGTCCGACCGCAACGGGCACCGCATCGACTTC
CTCTACGACGAGGCGGGCGTCGTCGCCGAGATGCGCCACTCGGGCGGCTACCGGGTGGCC
GTCGCCACGGAAGACGGCCGGGTCACGTCCCTGAGCGTTCTCAGCTCGCCGGAGGACGGC
TACGGCGTGGAAGCCGACTCACCGTGGGCGGTGGTGCGACGCTACGGCTACGACGCGGAG
GGCAATCTCCGCGCCGTCTCCGACGGGCAGGGCCGGGACTTCCGGCTCACCTACGACGCC
GAGTCCCGCATCACGAGCTGGACCGACCGCAACGGCGGTTGGTACCGCTACACCTACGAC
GAGCGGCACCGGGTCACGGCCGGCAGGGGAGCGGACGGTTTCCTGGACTGCTCCCTCACC
TACGACGACGCGGCACGCGTCAACACGTACCGCAACTCCCTCGGCCGCACCACCACCTAC
CGGTTCGACGAGCGTCTGCAACTCGTCCAGGTCACCGACCCGTTGGGAGCCTCCACTCAC
CGGGAGTGGGACGAGAACGGACGCCTCGTCGCCTGGACGGACCCGCTGGGCCGCACCACC
CGGCAGGTCTTCGACGCGGCCGGTCACCTGATCGAGGTGGTCAGGCCGGACCTCAGCTCT
GTCCGGGCCGAGTACGACGAGGCGGGCCGCACCCGCCGGCTCACGGACCCCGACGGTTCG
TTCTGGAGCTACACCTACGACGATCGGGGCAATCGCCTGACCGTCACCGACCCGTCCGGC
GCGACCACCCGCCACCGCTACGACGCCCTGGGGCGGCCCCTCTCGGTCACCGACGCGCTC
GGCCACACCCGGCACATCGAGACCGACCCGGCCGGTCTGCCGCTGGCCCTCACCGACCCG
GAGGGTCGGACGACCCGGGCGCGGCGCGACTCCTTCGGACGCGTGACCGCGGTGACCGAT
CCCACCGGTGCCACCGACCGCTTCGGGTGGACCGTCGAAGGACTGGCCTCATGGCGTTCC
TTCCCGGACGGCGCGACGGAGGCCTGGAGCTGGGACGGCGAAGGCAACCTCGCCTCGCAC
ACGGCCCGCAACGGCGCGGTCACCACGTACGAGTTCACCCACTTCCACCAGCCGACCTCC
CGCACCACACCGGACGGCCGCCGCTACACGTTCGCCTACGACACCGAACTGAACCTGACC
GGCGTCCACAACGCGGACGGCCGCACCTGGGAGTACGCCTACGACGACGCCAACCGCCTG
ATGCGGGAGACGGACTTCAACGGCCGCACGCTCACCTACACCCACGACGCGGCCGGGCAG
CGCACGTCGTGGACCAATGGCGCCGGACAGACCACGGACGTGACCGTGGACCTGCTCGGC
CGGCCACGCCAGTACCGCACGGCGGACGAGGTCACCACCTACGAGTACGACAGCGCCGGC
TCACTGCTCCGCGCGGCCAACCGCGACACCACGGTCGAACGCACCTACGACTCCATGGGT
CGCACGCTGACCGAGACGGTCAACGGCCGGACCACCACCTACACGTACGACGCACTCGGC
CGCCGCATCAGCCGACGCACTCCCTCGAGCATCACCTCGACCTGGACCTACGAGGCGACC
GGCCACCCCCAGACCCTGAGCGGCACCGGCAGCCGGCTGCGCTTCGACTACGACACCGCC
CATCGTGAGATCCGCAGGACGCTGGGCGCGGAGGCGGTGCTCCACCAGAGCTGGGACGGC
TCCGGCCGGCTGACCGGGCAGTCGGTGACCACGCCCGGCCGCGCCGGCGGCGACGCGGGC
GGAGAGCTGCTCCAGCACCGCACCTACGAGTACGACCCCGACGGAGCGCTCAGGGAGATC
GACGAGCTGCTCGGCGAAAGCCGCCGGTTCGACGTGGACCCGGTCGGCAGGCTGACCGCG
GTCAGGACCGCCGACCGCGAGGAGAGGTACGGGTACGACCGCGCGGGCAACCTCGTCACC
AGCTCCCCGTACGACGGCACCGCGGAACCGCGGCCCCACCATGTCGACGGGACCAGACTG
CACCGTGCCGGACGCACCACCTACGCCTACGACGGCCAGGGGCGCCTGATCCGCAAGACC
GTCCGACTCCTCAGCGGCGGCCGACGCACCTCCCAGTACGGGTGGAGCGCGGAGGACCGC
CTGGTCCGGACCGTCGCACCGGACGGATCCGAGTGGCGCTACACCTACGATCCGGACGGC
CGACGGGTCGGCAAACAACGCCTCGGCACCGGCGGGGACGTGCTGGAGGAGACGACGTTC
AGCTGGGACGGAACACGCCTCGCCGAACAGATCGAGACCGACGGCACCGTCACCACCTGG
GACTACGCGCCGGGATCCTACCGACCCGTCGCCCAGACGGTCAGCGGTGGCCGCGAACGG
CCGGCCGTGAACCGGGGCGGAAGCGACCCGGGCGACACCGACGCCCGCTTCTACGCCATC
GTCACCGACCTCGTCGGAACACCGACCGAACTCGTCTCGGCGGACGGCCGAATCGTCTGG
CACCGCAGATTCACCGCCTGGGGGCAGCCGACCGGCACACCGACCCCAGGCCCGGAAGCC
GACTGCCCCCTGCGCTTCCCCGGGCAGTACGCGGACGCCGAGACCGGCTGGAACTACAAC
TACTTCCGCTACTACGACCCGGAGACCGCGCGCTACGTCAGCGCCGATCCGCTGGGCCTG
GCACCGGACCCGAACGACTACGCCTACGTCACCAACCCGCTCCTTCTCCTCGACCCGCTG
GGCCTCATCCGCATCCGCGGCCAGCGCGGCCGATGGGAGAGGGACCCGAACTCGCCCGGC
GTACAGGCCCACAACCGCGACACCGAATACCCCGGCAGCTATCGCCAGTCCACCCACGAC
GCCATGACCGCCGCCTGGACCGACGAGGGCATCGCCCAGGGCGGCACACCCATGCGACCC
ACCGGACAGCTCGACCCCCAGGGCCGTCAGATCATGGAACGCATTCCCAGATCGGAGCTG
ACCTGGCGCAACTCCGCGGGCGAGATCATCCCGTCCAACCAGCTCACGTACGAGCACCTG
ACGCCGGTGGTCGATCACTGGAACCAGACGGGCTACCGTTCCGACCGGGCCACCCGCAAC
GACTTCTACAACGATCCCGACAACATGGAGCCCATGACGAGAAGCGAGAATTCCCGCGGC
GGTGCGCTCATGGACGCCACCTACCGCCAGGATGTCGACCCCACCCTCTACTCATGCAGC
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006530 YD repeat (Repeat)
 [557-593]  1.2e-07 TIGR01643 [644-681]  6.59999999999999e-07 TIGR01643 [663-701]  1.3e-06 TIGR01643 [685-725]  0.00018 TIGR01643 [705-738]  4.29999999999999e-06 TIGR01643 [726-767]  6.80000000000001e-09 TIGR01643 [769-804]  2e-06 TIGR01643 [822-851]  0.0011 TIGR01643 [856-892]  8.79999999999999e-07 TIGR01643 [894-933]  1.4e-05 TIGR01643 [976-1015]  2.5e-05 TIGR01643 [1113-1139]  0.0016 TIGR01643 [1161-1182]  0.0017 TIGR01643 [1195-1226]  7e-07 TIGR01643
TIGR01643   YD_repeat_2x
 [578-607]  4.4e-05 PF05593 [663-697]  5.3e-07 PF05593 [705-742]  1.2e-09 PF05593 [728-763]  1.5e-07 PF05593 [769-805]  4.40000000000001e-06 PF05593 [831-867]  1.1e-06 PF05593 [873-910]  3.4e-06 PF05593 [894-931]  4.9e-07 PF05593 [976-1009]  1.1e-05 PF05593 [1195-1224]  0.0001 PF05593
PF05593   RHS_repeat
IPR022385 Rhs repeat-associated core (Domain)
 [1325-1402]  2.8e-21 TIGR03696
TIGR03696   Rhs_assc_core
SignalP
 [1-1]  0.239 Signal
Eukaryota   
TMHMM
 [250-272]  Transmembrane (i-o)
Transmembrane 1