close all open/close all

CDS information : Alip_00190


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction63,125 / 61,941 / - [in whole cluster]
63,125 / 61,941 / - [in contig]
Locationcomplement(61941..63125) [in whole cluster]
complement(61941..63125) [in contig]
TypeCDS
Length1,185 bp (394 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative S12 family peptidase
Product (GenBank)LipX4
Gene
Gene (GenBank)lipX4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
P94288
PmId
[8939979] An alkaline D-stereospecific endopeptidase with beta-lactamase activity from Bacillus cereus. (J Biol Chem. , 1996)
ACC
Q93I82
PmId
[14612229] Genes for an alkaline D-stereospecific endopeptidase and its homolog are located in tandem on Bacillus cereus genome. (FEMS Microbiol Lett. , 2003)
ACC
P15555
PmId
[3830154] Primary structure of the Streptomyces R61 extracellular DD-peptidase. 1. Cloning into Streptomyces lividans and nucleotide sequence of the gene. (Eur J Biochem. , 1987)
[3030739] Primary structure of the Streptomyces R61 extracellular DD-peptidase. 2. Amino acid sequence data. (Eur J Biochem. , 1987)
[2175384] Transcriptional analysis of the DD-peptidase/penicillin-binding protein-encoding dac gene of Streptomyces R61: use of the promoter and signal sequences in a secretion vector. (Mol Gen Genet. , 1990)
[7490745] The refined crystallographic structure of a DD-peptidase penicillin-target enzyme at 1.6 A resolution. (J Mol Biol. , 1995)

close this sectionSequence

selected fasta
>putative S12 family peptidase [LipX4]
MTSTLRKHLVMALGVATLLTAEVVPAIAQPAAPSPAEQLRQDTKAIHALGVSGVQARVIA
PDGRQSVATSGTADLNTGRPVSSGGYFRMASTSKTLVATVVLQLEAEGRLSLDDTVDHWL
PGVVRGNGNDGSRVTIHHLLQHTSGIRDALPGYTTPEEYYQQRHIIYEPKQLVDLAMAHE
PEDFVPGKGWAYSNTGYVLLDMIIQKATGHPAHQEIKNRILGPLGLDRTRWVGASPTLPR
PHAQAYQLFGPGSRVDVTDQIPVDYANLSWVTTTRDENRFFRALLDGRLLPARQLAKMKQ
TVAVSAEVQELWPDGRYGLGLVERPLGCGGTYWSHEGGDGGYITLNGVTDDGRRSAVVSM
SEARGDTKEHILEQENAASALIDHALCAGGPNTR
selected fasta
>putative S12 family peptidase [LipX4]
ATGACTTCGACTCTGAGGAAGCACCTGGTCATGGCACTCGGTGTCGCTACGCTGCTCACC
GCCGAGGTGGTCCCCGCCATCGCTCAGCCGGCCGCTCCCTCCCCGGCGGAGCAGTTACGT
CAGGACACCAAGGCGATCCACGCCCTCGGCGTGAGCGGTGTGCAGGCCCGCGTGATCGCG
CCTGACGGTCGGCAGTCGGTCGCCACCAGCGGTACCGCCGACCTGAACACCGGCCGCCCG
GTCTCTTCCGGCGGCTACTTCCGCATGGCCAGCACGTCCAAGACGCTGGTCGCCACCGTG
GTCCTCCAACTGGAGGCCGAGGGCAGACTGTCCCTGGACGACACGGTCGACCACTGGCTT
CCCGGAGTGGTGCGGGGCAACGGCAACGACGGCAGCCGGGTCACCATCCACCACCTGCTC
CAGCACACCAGCGGTATCCGGGACGCCCTGCCCGGATACACCACGCCGGAGGAGTACTAC
CAGCAGCGCCACATCATCTACGAACCCAAGCAGCTGGTCGACCTCGCCATGGCTCATGAG
CCCGAGGACTTCGTGCCCGGCAAGGGCTGGGCGTACTCCAACACCGGCTACGTCCTGCTC
GACATGATCATCCAGAAGGCCACCGGTCACCCAGCTCACCAAGAGATCAAGAACCGCATC
CTGGGCCCGCTGGGCCTCGACCGGACCCGGTGGGTGGGCGCTTCGCCCACCCTGCCCCGG
CCTCACGCCCAGGCTTACCAGCTCTTCGGCCCCGGTTCCCGGGTGGATGTCACCGACCAG
ATACCGGTGGACTACGCGAACCTTTCGTGGGTCACGACCACTCGGGATGAGAACCGCTTC
TTCCGCGCGCTGCTCGACGGCCGCCTGCTGCCGGCAAGGCAGCTGGCCAAGATGAAGCAG
ACCGTCGCCGTGAGTGCGGAGGTCCAAGAGCTGTGGCCGGACGGCCGATACGGGCTCGGC
CTGGTCGAACGCCCCCTGGGATGCGGGGGAACCTACTGGAGCCATGAGGGCGGGGACGGC
GGCTACATCACCCTCAACGGCGTCACCGATGACGGGCGTCGAAGCGCTGTGGTCTCCATG
TCCGAGGCCCGCGGCGACACCAAGGAGCACATACTGGAGCAGGAGAACGCGGCCAGCGCC
CTGATCGACCACGCACTGTGCGCCGGGGGCCCCAACACCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001466 Beta-lactamase-related (Domain)
 [51-377]  1.9e-55 PF00144
PF00144   Beta-lactamase
IPR012338 Beta-lactamase/transpeptidase-like (Domain)
 [28-384]  2.0000139277205e-67 SSF56601
SSF56601   PBP_transp_fold
 [44-363]  4.10000000000004e-60 G3DSA:3.40.710.10
G3DSA:3.40.710.10   G3DSA:3.40.710.10
SignalP
 [1-28]  0.998 Signal
Eukaryota   
 [1-28]  0.998 Signal
Bacteria, Gram-negative   
 [1-28]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit