close all open/close all

CDS information : Alip_00200


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction64,303 / 63,320 / - [in whole cluster]
64,303 / 63,320 / - [in contig]
Locationcomplement(63320..64303) [in whole cluster]
complement(63320..64303) [in contig]
TypeCDS
Length984 bp (327 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)LipDig3
Gene
Gene (GenBank)lipDig3
EC number
Keyword
  • D-digitoxose
  • axial-OH
Note
Note (GenBank)
  • putative 3-ketoreductase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
Q9XC70
PmId
[16448097] A two-stage one-pot enzymatic synthesis of TDP-L-mycarose from thymidine and glucose-1-phosphate. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [LipDig3]
MHYTRLGRTALKISRLCVGTVNFGGRVDEEDGHRILDRALDLGLNFVDTANMYGWRVHKG
YTEETIGRWFAKDPSCRDRTVLATKVGNEMSGAPNQSGLSARHIVASCEASLRRLQTDRI
DLFQLHHVDRTAPWDEIWQALDLLVSQGKVLYVGSSNFAGWHVAMAQEAAGRRHFLGLVS
EQCAYNLVTRLPELELIPAARAYGMAVLPWSPLHGGLLGGVLAKLREGSAVKSAQGRAVP
ALEEHRGRIEAYEELCRELGEHPAQVGLAWVLSRPGVTAPVIGPRSVEQLDSAVAALDLT
LPHDALTRLDALFPGPRAEAPEAWITT
selected fasta
>putative NDP-hexose C-3 ketoreductase [LipDig3]
ATGCACTACACACGTCTGGGCCGCACCGCACTGAAGATCAGCAGATTGTGCGTGGGAACG
GTCAACTTCGGCGGACGGGTGGACGAGGAGGACGGGCACCGCATCCTGGACCGCGCCCTC
GACCTGGGCCTCAACTTCGTCGACACCGCCAACATGTACGGCTGGCGCGTGCACAAGGGC
TATACGGAGGAGACGATCGGCCGCTGGTTCGCCAAGGACCCGTCCTGCCGGGACCGGACC
GTGCTGGCCACCAAGGTCGGCAATGAGATGTCCGGCGCGCCCAACCAGAGCGGTCTGTCG
GCCCGACACATCGTCGCGTCCTGCGAGGCGTCCCTGCGCCGACTGCAGACCGACCGCATC
GACCTCTTCCAACTGCACCACGTGGACCGCACGGCGCCCTGGGACGAGATCTGGCAGGCA
CTGGACCTGCTGGTGAGCCAGGGAAAGGTGCTGTACGTGGGCTCGTCCAACTTCGCGGGC
TGGCACGTGGCCATGGCCCAGGAGGCGGCCGGCCGGCGGCACTTCCTCGGCCTGGTCTCC
GAGCAGTGCGCGTACAACCTGGTCACCCGCCTGCCCGAGCTGGAACTCATCCCCGCCGCG
CGCGCCTATGGCATGGCCGTGCTGCCGTGGTCGCCACTGCACGGCGGACTGCTCGGCGGG
GTCCTCGCCAAGCTGCGCGAGGGGAGCGCGGTCAAGTCGGCGCAGGGGCGGGCGGTGCCG
GCTCTGGAGGAGCACCGCGGCCGTATCGAAGCCTACGAAGAGCTGTGCCGTGAGCTGGGC
GAGCACCCCGCTCAGGTCGGCCTCGCCTGGGTGCTGTCGCGTCCGGGGGTGACCGCTCCC
GTCATCGGCCCGCGCAGTGTCGAGCAGTTGGACAGCGCGGTCGCCGCGTTGGACCTCACT
CTGCCGCACGATGCTCTGACCCGTCTCGACGCGTTGTTCCCGGGGCCGCGCGCGGAGGCA
CCGGAGGCGTGGATCACGACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [1-321]  2.7000136937899e-91 SSF51430
SSF51430   Aldo/ket_red
 [1-314]  3.79999999999991e-88 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [15-313]  3.49999999999995e-69 PF00248
PF00248   Aldo_ket_red
SignalP No significant hit
TMHMM No significant hit