close all open/close all

CDS information : Alip_00210


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction65,414 / 64,347 / - [in whole cluster]
65,414 / 64,347 / - [in contig]
Locationcomplement(64347..65414) [in whole cluster]
complement(64347..65414) [in contig]
TypeCDS
Length1,068 bp (355 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)LipDig4
Gene
Gene (GenBank)lipDig4
EC number
Keyword
  • D-digitoxose
Note
Note (GenBank)
  • putative 4-ketoreductase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
Q331Q7
PmId
[17053005] Biosynthesis of dTDP-6-deoxy-beta-D-allose, biochemical characterization of dTDP-4-keto-6-deoxyglucose reductase (GerKI) from Streptomyces sp. KCTC 0041BP. (Glycobiology. , 2007)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [LipDig4]
MTGGTRGADRRRRGAGGAGRRSRASEKHWAGKRVVVTGGLGFIGSHFVEQLLEHGACVTC
VHRGEKPEVLEVLPSANRARLLSLDLLDDTALSAALRSVTPRVDLIVHCAALYGNADFKK
RNPALILDANMRMASNVLRAARACDVGDVVMMGSAEIYSELAPSPAREDDDYRRYPVPTQ
NGYALAKIYTEMLAEFFRTQYGMRIFVPRPTNVYGPRDDFDASVSRVVPSLMNRIARGED
IEIWGDGSQTRTFVHVRDVVRATLRMAESNRHHTLNIGTREEISILGLAKLLSSVFGAPE
SIRLVPARPTGPGARTLDVGRMDELIDFEPTALRDGLEETARWYRRTRYQAATAG
selected fasta
>putative NDP-hexose C-4 ketoreductase [LipDig4]
ATGACCGGCGGCACGCGGGGGGCCGACCGTCGGCGCCGGGGAGCCGGCGGAGCCGGCCGC
CGCTCCCGAGCGTCCGAGAAGCACTGGGCAGGGAAGAGGGTCGTCGTCACCGGCGGACTC
GGATTCATCGGCTCGCATTTCGTCGAACAACTTCTGGAACACGGCGCCTGTGTAACGTGT
GTCCACCGCGGCGAGAAGCCGGAGGTACTGGAGGTTCTGCCATCGGCGAACCGCGCCCGG
CTCCTTTCGCTCGACCTTCTGGACGACACTGCGCTGTCCGCCGCGCTCCGCTCCGTCACG
CCGCGGGTCGACCTGATCGTGCACTGCGCCGCCCTGTACGGGAACGCGGATTTCAAGAAG
CGCAACCCGGCGCTGATACTCGACGCGAACATGCGGATGGCGTCAAACGTTCTCAGGGCC
GCCCGGGCCTGCGACGTCGGCGACGTCGTCATGATGGGATCGGCGGAGATCTACTCGGAA
CTCGCGCCGAGTCCGGCCCGCGAGGACGACGACTACCGCCGATATCCGGTCCCCACGCAG
AACGGCTATGCGTTGGCGAAGATCTACACCGAGATGCTGGCAGAGTTCTTTCGCACGCAG
TACGGCATGCGGATCTTCGTACCCAGACCGACGAACGTCTACGGCCCGCGGGACGACTTC
GACGCATCCGTCAGCCGGGTCGTCCCGAGCCTGATGAACCGCATCGCCCGCGGCGAGGAC
ATCGAGATCTGGGGCGACGGCAGCCAGACGCGCACCTTCGTTCACGTCCGGGACGTCGTG
CGTGCCACCCTGCGCATGGCGGAGTCGAACCGGCACCACACCCTCAACATCGGGACCCGC
GAGGAGATCTCGATCCTCGGCCTGGCCAAGCTCCTGTCGTCGGTGTTCGGCGCACCCGAG
TCCATCCGGCTCGTCCCGGCCAGGCCCACCGGCCCCGGCGCGCGAACCCTGGACGTCGGC
CGGATGGACGAGCTGATCGACTTCGAGCCGACCGCCCTGCGGGACGGGCTGGAGGAGACC
GCGCGGTGGTACCGCCGGACGAGGTACCAAGCGGCCACGGCCGGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [34-278]  8.89999999999994e-56 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [26-209]  1.6e-35 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-24]  0.278 Signal
Bacteria, Gram-negative   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM No significant hit