close all open/close all
Alip_00210 Alip_00210   last last

CDS information : Alip_00220


close this sectionLocation

Organism
StrainTü117
Entry nameAlpha-lipomycin
Contig
Start / Stop / Direction66,871 / 65,411 / - [in whole cluster]
66,871 / 65,411 / - [in contig]
Locationcomplement(65411..66871) [in whole cluster]
complement(65411..66871) [in contig]
TypeCDS
Length1,461 bp (486 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)LipDig5
Gene
Gene (GenBank)lipDig5
EC number
Keyword
  • D-digitoxose
Note
Note (GenBank)
  • putative 2,3-dehydratase
Reference
ACC
PmId
[16723573] Biosynthetic gene cluster for the polyenoyltetramic acid alpha-lipomycin. (Antimicrob Agents Chemother. , 2006)
Related Reference
ACC
Q845B8
PmId
[12889805] Functional identification of rub52 gene involved in the biosynthesis of rubradirin. (Biotechnol Lett. , 2003)
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [LipDig5]
MSEVTTRAATTDSTAQKPGGGTRGRPADRPATGPRWDRRTTDLLARSALVTERGAGPATA
SSPTGSPTRGREHAFRVRRIDFAELKGWHFRQPTGNLAHQSGRFFTVEGLRVRTSAGSFP
EWHQPIIRQPEVGILGILAKEIDGVLHFLMQAKMEPGNPNLLQLSPTVQATRSNYTRVHR
GAPVRYVEYFAGPRQGRILADVLQSEHGSWFYRKHNRNMIVETRDEVPPHPDFCWLTLGQ
LYELLRRDNTVNMDSRTVLSSLPPLAELPDSRLALTPDAEVLSWLTEHRSTQDWTIELCP
LTGLPGWARTEREISREDGRFFDVVAVAVEAGNREVPSWTQPLIEPHGEGVAAFLLHEFD
GVPHVLAHARMEGGLPLVVEVAPTVQCVPANYPEDRRPRYLDEVLAAPPARIRYNAVHAE
EGGRFRNAVSRYLIVESDGALAAEPLPPGYAWLSVRQLERLTSAGLSVNVQARTLLACLR
SVARPS
selected fasta
>putative NDP-hexose 2,3-dehydratase [LipDig5]
GTGTCGGAAGTGACGACACGTGCAGCGACGACGGACTCCACCGCGCAGAAACCGGGCGGT
GGCACTCGCGGGCGACCTGCGGACCGGCCCGCGACCGGTCCGCGCTGGGACCGGCGGACC
ACGGATCTTCTGGCCCGGTCGGCCCTGGTGACCGAGCGGGGCGCAGGGCCGGCCACCGCG
AGTTCGCCGACTGGCTCGCCGACCCGCGGACGCGAACACGCCTTCCGGGTGCGGCGGATC
GATTTCGCCGAACTGAAAGGTTGGCATTTCCGTCAGCCGACCGGAAACCTGGCCCACCAG
TCCGGCAGGTTCTTCACCGTGGAAGGACTGCGGGTCCGCACCTCGGCCGGGTCCTTCCCT
GAATGGCATCAACCGATCATCCGGCAACCCGAGGTCGGCATTCTCGGAATCCTGGCGAAG
GAAATCGACGGTGTTCTGCATTTTCTGATGCAGGCGAAGATGGAGCCCGGGAACCCGAAC
CTGCTGCAGCTGTCGCCGACCGTGCAGGCGACCCGCAGCAACTACACGCGTGTGCACCGA
GGTGCGCCCGTCAGATACGTGGAGTACTTCGCCGGGCCGCGCCAGGGCCGGATCCTGGCG
GACGTGCTGCAGTCCGAGCACGGCTCCTGGTTCTACCGCAAGCACAACCGCAACATGATC
GTCGAGACCCGCGACGAGGTGCCCCCGCACCCCGACTTCTGCTGGCTCACCCTCGGTCAG
CTCTACGAACTGCTCCGCCGGGACAACACGGTCAACATGGACTCCCGCACCGTGCTGTCC
AGCTTGCCCCCTCTCGCGGAGCTGCCGGACAGCCGACTGGCGCTCACCCCGGACGCGGAA
GTCCTGAGCTGGCTCACCGAGCACCGCTCCACGCAGGACTGGACGATCGAGCTGTGCCCG
CTGACCGGGCTGCCCGGCTGGGCGCGCACCGAGCGCGAGATCAGCCGCGAGGACGGGCGC
TTCTTCGATGTCGTCGCGGTCGCCGTGGAGGCCGGCAACCGTGAGGTGCCGAGCTGGACG
CAGCCGCTGATCGAACCGCACGGCGAGGGCGTGGCCGCGTTTTTGCTGCACGAATTCGAC
GGCGTACCCCACGTCCTGGCGCACGCCCGCATGGAGGGCGGCCTGCCCCTGGTGGTCGAG
GTGGCGCCCACGGTCCAGTGCGTCCCCGCCAACTACCCCGAGGACAGGCGTCCCCGCTAC
CTCGACGAGGTGCTGGCCGCGCCGCCCGCCCGGATCCGGTACAACGCCGTGCACGCCGAG
GAGGGCGGCCGTTTCCGCAACGCCGTCAGCCGTTACCTCATCGTCGAGTCCGACGGCGCC
CTCGCCGCCGAGCCGCTGCCGCCCGGGTACGCCTGGCTGAGCGTGCGTCAGCTGGAACGG
CTCACCAGCGCCGGGCTGAGCGTCAACGTCCAGGCGCGGACCCTGCTCGCGTGCCTGCGT
TCCGTGGCGCGGCCGTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [70-262]  1e-83 PF03559 [278-479]  1.9e-74 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit
Alip_00210 Alip_00210   last last