close all open/close all
first first   Alnu_00020 Alnu_00020

CDS information : Alnu_00010


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction7 / 513 / + [in whole cluster]
7 / 513 / + [in contig]
Location7..513 [in whole cluster]
7..513 [in contig]
TypeCDS
Length507 bp (168 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative MarR family transcriptional regulator
Product (GenBank)AlnR1
Gene
Gene (GenBank)alnR1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR000835

close this sectionSequence

selected fasta
>putative MarR family transcriptional regulator [AlnR1]
MADLEVEAMSEEPEAEAGSRLTAEEAVRAMLVTLPRLVSRAKRTPVPEQLRSLRLAPRHL
SLLSCLIFDGPTSVKDLAARLEVAPTTVSLMVSDLQREGVVERRSDPDDRRRSIVSLTED
PTTRAAIDAWLASGARAWRKVFDDLSPQERATFVRAIQRYEEAVAEAP
selected fasta
>putative MarR family transcriptional regulator [AlnR1]
GTGGCGGACCTGGAGGTCGAAGCGATGTCAGAGGAGCCGGAGGCGGAGGCGGGCAGTCGT
CTCACCGCCGAAGAGGCGGTCCGGGCGATGCTGGTCACCCTGCCTCGGCTGGTCTCCCGT
GCCAAGCGCACCCCCGTGCCCGAGCAGTTGCGCTCGTTGCGGCTGGCGCCCCGGCACCTC
TCCCTGCTGTCCTGTCTCATCTTCGACGGGCCCACGTCCGTCAAGGACCTCGCCGCTCGG
CTGGAGGTCGCGCCGACCACGGTCAGTCTGATGGTCAGCGATCTGCAGCGCGAGGGTGTT
GTGGAGCGCCGGTCCGATCCCGACGACCGCAGGCGCAGCATCGTCTCGCTGACCGAGGAT
CCCACCACCCGCGCGGCCATTGACGCCTGGCTGGCCAGTGGGGCCAGGGCCTGGCGCAAG
GTCTTCGACGACCTCAGTCCGCAGGAGCGCGCGACCTTCGTACGGGCCATCCAGCGTTAC
GAGGAAGCCGTCGCCGAAGCACCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000835 Transcription regulator HTH, MarR-type (Family)
 [28-162]  PS50995
PS50995   HTH_MARR_2
 [48-150]  3.0999994589937e-14 SM00347
SM00347   HTH_MARR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [36-167]  5.40000000000002e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit
first first   Alnu_00020 Alnu_00020