close all open/close all

CDS information : Alnu_00020


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction1,178 / 483 / - [in whole cluster]
1,178 / 483 / - [in contig]
Locationcomplement(483..1178) [in whole cluster]
complement(483..1178) [in contig]
TypeCDS
Length696 bp (231 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative nucleotidyltransferase
Product (GenBank)Aln1
Gene
Gene (GenBank)aln1
EC number2.7.7.-
Keyword
  • coenzyme F420
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
A0QUZ4
PmId
[17660436] Mycobacterium smegmatis mc2 155 fbiC and MSMEG_2392 are involved in triphenylmethane dye decolorization and coenzyme F420 biosynthesis. (Microbiology. , 2007)

close this sectionSequence

selected fasta
>putative nucleotidyltransferase [Aln1]
MWSVVLPVKSFSRAKSRLAAGLGPWRQELAHAFFLDTLWAVRNTEGVRTVVVVTADPLAA
SQARTLGALVCPDAPDPDLNDAIRLGAAKCRSVGPEGPVAVLTADLPGLRPRELEHVLGE
ARHHQRAFVADHTGEGTTVLTALTTSGISPAFGTDSAHRHASLGAFPVDMPSDCGIRLDV
DTPEDLARVALRGVGPYTAALFRLRKARYPVAADPVQAVEGVQGASATASS
selected fasta
>putative nucleotidyltransferase [Aln1]
GTGTGGTCGGTGGTGCTCCCGGTCAAGTCGTTCAGCAGGGCCAAGAGCCGGCTAGCGGCA
GGGCTGGGGCCGTGGCGCCAGGAACTGGCCCACGCCTTCTTCCTGGACACACTCTGGGCC
GTACGCAACACCGAAGGGGTCCGTACGGTCGTGGTGGTGACGGCCGATCCCCTGGCCGCC
TCGCAGGCCCGCACCCTGGGCGCGCTGGTCTGCCCGGACGCACCCGATCCCGACCTCAAC
GACGCCATACGCCTGGGGGCCGCCAAGTGCCGCTCGGTGGGCCCCGAGGGCCCGGTGGCG
GTACTCACCGCCGACCTGCCGGGCCTGCGTCCACGCGAACTGGAGCACGTCCTAGGGGAG
GCCCGTCACCACCAACGGGCCTTCGTAGCCGACCACACAGGCGAAGGAACCACCGTCCTG
ACCGCACTCACCACCTCCGGCATCTCGCCCGCCTTCGGCACGGACTCCGCCCACCGGCAC
GCCTCGCTCGGGGCGTTCCCCGTCGACATGCCGAGCGACTGCGGCATCCGGCTGGACGTG
GACACCCCGGAGGACCTGGCGCGGGTGGCGCTGCGAGGGGTGGGGCCGTACACGGCGGCG
CTGTTCCGCCTACGGAAGGCGAGGTATCCGGTGGCGGCCGACCCCGTCCAGGCCGTTGAG
GGCGTTCAGGGTGCTTCGGCGACGGCTTCCTCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002835 2-phospho-L-lactate guanylyltransferase, CofC (Family)
 [4-211]  1.2e-12 PF01983
PF01983   CofC
 [4-197]  3.2e-46 TIGR03552
TIGR03552   F420_cofC
SignalP
 [1-32]  0.434 Signal
Bacteria, Gram-positive   
 [1-40]  0.638 Signal
Eukaryota   
TMHMM No significant hit