close all open/close all

CDS information : Alnu_00030


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction1,701 / 1,183 / - [in whole cluster]
1,701 / 1,183 / - [in contig]
Locationcomplement(1183..1701) [in whole cluster]
complement(1183..1701) [in contig]
TypeCDS
Length519 bp (172 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Aln2
Gene
Gene (GenBank)aln2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q53925
NITE
Actino_00020
PmId
[17227452] Possible involvement of ActVI-ORFA in transcriptional regulation of actVI tailoring-step genes for actinorhodin biosynthesis. (FEMS Microbiol Lett. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [Aln2]
MTTDETTTTDATTITDATTIADATTRNAPKLPSPELYVEVTQFYARQMHRMDGDDFGGFA
ATFVAGAEFRLAGGTVLTGPEAIEAGARAAAGRFDGAQPRHWFDMMTVEEADDGTVSTSY
YATVTVTSAQGAVLVEPTCFVRDTLVRVSGVLRSRSRVIERDDLVVRARTQG
selected fasta
>hypothetical protein [Aln2]
ATGACGACTGACGAGACGACGACCACTGACGCGACAACAATCACGGACGCAACGACGATC
GCGGACGCGACGACGAGGAACGCTCCCAAACTCCCCTCCCCCGAGCTGTACGTGGAGGTG
ACACAGTTCTACGCCCGGCAGATGCACCGGATGGACGGGGACGACTTCGGCGGTTTCGCC
GCCACGTTCGTCGCGGGCGCGGAGTTCCGCCTCGCGGGCGGCACCGTACTCACCGGCCCC
GAGGCGATCGAGGCGGGCGCGCGGGCGGCGGCGGGCAGGTTCGACGGCGCGCAGCCCCGG
CACTGGTTCGACATGATGACGGTCGAGGAGGCCGACGACGGCACGGTGTCCACCAGCTAC
TACGCGACGGTGACGGTCACTTCGGCGCAGGGTGCCGTCCTGGTGGAGCCGACCTGCTTC
GTCCGGGACACCCTGGTCCGGGTGTCCGGTGTGCTGCGCAGCAGGTCCCGGGTCATCGAG
CGGGACGACCTCGTGGTGCGCGCCCGGACGCAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit