close all open/close all

CDS information : Alnu_00040


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction1,823 / 2,077 / + [in whole cluster]
1,823 / 2,077 / + [in contig]
Location1823..2077 [in whole cluster]
1823..2077 [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative acyl carrier protein
Product (GenBank)AlnJ starter unit acyl carrier protein
Gene
Gene (GenBank)alnJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
O68916
NITE
Fren_00100
PmId
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
ACC
Q9F6D5
NITE
R1128_00070
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>putative acyl carrier protein [AlnJ starter unit acyl carrier protein]
MAEFTITEFQSVVNACFDGATSEEIKDSTLHTEFTDLGFDSLTVYEIVTRIQDDFKVSVP
DEQLDELTTPAALIQYVQGQLTTV
selected fasta
>putative acyl carrier protein [AlnJ starter unit acyl carrier protein]
ATGGCTGAATTCACCATCACCGAGTTCCAGAGCGTCGTGAACGCCTGCTTCGACGGAGCC
ACCAGTGAGGAGATCAAGGATTCCACGCTGCACACCGAGTTCACCGACCTCGGTTTCGAC
TCGCTCACCGTGTACGAGATCGTGACCCGTATCCAGGACGACTTCAAGGTCAGCGTGCCT
GACGAACAGCTTGACGAACTCACCACTCCCGCCGCCCTCATCCAGTACGTCCAAGGTCAG
CTCACCACTGTGTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003231 Acyl carrier protein (ACP) (Family)
 [39-78]  PD000887
PD000887   PD000887
IPR009081 Acyl carrier protein-like (Domain)
 [2-81]  2.89999717862184e-15 SSF47336
SSF47336   ACP_like
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [19-81]  2.90000000000001e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [23-77]  1.7e-14 PF00550
PF00550   PP-binding
SignalP
 [1-15]  0.108 Signal
Eukaryota   
TMHMM No significant hit