close all open/close all

CDS information : Alnu_00050


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction3,303 / 2,059 / - [in whole cluster]
3,303 / 2,059 / - [in contig]
Locationcomplement(2059..3303) [in whole cluster]
complement(2059..3303) [in contig]
TypeCDS
Length1,245 bp (414 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative acyl-ACP thioesterase
Product (GenBank)AlnK starter unit acyl transferase
Gene
Gene (GenBank)alnK
EC number
Keyword
  • type II thioesterase
  • non-acetate starter unit
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9KHK3
NITE
Enter_00120
PmId
[21531566] Policing starter unit selection of the enterocin type II polyketide synthase by the type II thioesterase EncL. (Bioorg Med Chem. , 2011)
ACC
Q9F6D9
NITE
R1128_00030
PmId
[15260498] The acyltransferase homologue from the initiation module of the R1128 polyketide synthase is an acyl-ACP thioesterase that edits acetyl primer units. (Biochemistry. , 2004)

close this sectionSequence

selected fasta
>putative acyl-ACP thioesterase [AlnK starter unit acyl transferase]
MERRRTVLLLPGQGAQRERMAAGLYEAREEFTAPMDEFFGRLGTTGARLRSAWLRPAPNP
ELDESAVAQPLLLAVGHALGRAVGTAAEPPALLLGHSVGELAAACLAGVFDPADIGALAA
ARSRSLEGTGYGGMLAVAATEGQLAEELGGFGEGAELSGSAEGMAAGADGVTVAGAADGV
TVSGMGVGADGVTVSGVADRAAVAGVTAAGVADGRVAVGTAFAGVAVAALNGPRQTVLAG
PREALDAVEQHLRDRGFLVRALRSGHAFHSPAMEGAALRFAEALAAFGPCAPRATAGTVV
STRTGVAVTAEQARDPHFWGGQLAAPVRYWPALRELLDTLGRRPGLLLLDGSADRSLSAP
ARHHPAVRDGASEVVPLLAVGRDAGGPADARVFAEALHRLGEQRDHTGDHTVVS
selected fasta
>putative acyl-ACP thioesterase [AlnK starter unit acyl transferase]
GTGGAGCGCCGTCGAACAGTGCTGCTGCTGCCCGGACAGGGTGCGCAGCGGGAACGTATG
GCCGCCGGACTGTACGAAGCGCGGGAGGAGTTCACCGCGCCCATGGACGAGTTCTTCGGC
CGGCTCGGCACGACAGGCGCACGGCTGCGGTCGGCATGGCTGCGCCCCGCGCCCAACCCG
GAGCTGGACGAGTCGGCGGTGGCGCAGCCACTGCTGCTCGCCGTGGGCCACGCGCTGGGA
CGTGCGGTGGGCACGGCGGCGGAACCTCCCGCGCTGCTGCTCGGACACAGCGTGGGCGAG
CTGGCGGCGGCCTGCCTGGCGGGCGTCTTCGATCCGGCGGACATCGGCGCGCTGGCCGCC
GCCCGCTCCCGGTCGCTGGAGGGCACGGGGTACGGCGGGATGCTCGCGGTGGCGGCGACG
GAGGGGCAACTGGCCGAAGAGCTCGGGGGGTTCGGCGAAGGGGCGGAACTCAGCGGTTCT
GCCGAGGGGATGGCCGCCGGAGCCGACGGGGTGACGGTCGCGGGGGCTGCCGACGGGGTG
ACCGTGTCGGGGATGGGCGTCGGAGCCGACGGGGTGACCGTGTCGGGGGTGGCCGACCGG
GCGGCTGTCGCAGGGGTGACCGCGGCCGGGGTGGCCGACGGGAGGGTGGCTGTTGGGACG
GCCTTCGCCGGGGTGGCCGTCGCGGCGCTCAACGGACCGCGTCAGACGGTGCTGGCGGGC
CCGCGGGAGGCGCTGGACGCCGTGGAGCAACACCTGCGGGACCGCGGGTTCCTGGTACGC
GCGCTGCGTTCGGGGCACGCCTTCCACAGCCCCGCCATGGAAGGGGCCGCGCTGCGCTTC
GCCGAGGCACTGGCGGCGTTCGGGCCGTGTGCTCCCCGGGCGACCGCCGGCACGGTGGTG
TCCACCCGCACCGGGGTAGCGGTGACCGCGGAACAGGCGCGGGATCCGCACTTCTGGGGC
GGGCAGTTGGCCGCCCCGGTGCGGTACTGGCCGGCCCTGCGGGAACTGCTGGACACCTTG
GGGAGGCGGCCGGGGCTGCTGCTGCTCGACGGCTCCGCGGACCGGAGCCTGAGCGCCCCC
GCCCGGCACCACCCCGCGGTGCGGGACGGCGCCAGCGAGGTGGTCCCCCTGCTGGCCGTC
GGCCGGGACGCCGGTGGCCCGGCCGACGCGCGGGTCTTCGCCGAGGCGCTGCACCGGCTG
GGGGAACAGCGGGATCACACAGGGGATCACACAGTGGTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [3-129]  6.40000000000004e-38 G3DSA:3.40.366.10 [266-365]  6.40000000000004e-38 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [9-203]  5.59999999999999e-15 PF00698 [204-338]  2.9e-12 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [5-338]  2.19999900980708e-32 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [199-265]  9.59999914716171e-10 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
SignalP No significant hit
TMHMM No significant hit