close all open/close all

CDS information : Alnu_00070


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction4,743 / 6,029 / + [in whole cluster]
4,743 / 6,029 / + [in contig]
Location4743..6029 [in whole cluster]
4743..6029 [in contig]
TypeCDS
Length1,287 bp (428 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)AlnM ketoacyl synthase beta
Gene
Gene (GenBank)alnM
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9KHK5
NITE
Enter_00100
PmId
[15123240] Context-dependent behavior of the enterocin iterative polyketide synthase; a new model for ketoreduction. (Chem Biol. , 2004)
[17704772] Enzymatic total synthesis of enterocin polyketides. (Nat Chem Biol. , 2007)
ACC
Q02062
NITE
Actino_00190
PmId
[10519556] A chain initiation factor common to both modular and aromatic polyketide synthases. (Nature. , 1999)
[10684659] Mechanistic analysis of a type II polyketide synthase. Role of conserved residues in the beta-ketoacyl synthase-chain length factor heterodimer. (Biochemistry. , 2000)
[15286722] An antibiotic factory caught in action. (Nat Struct Mol Biol. , 2004)
[18034463] Dissecting the component reactions catalyzed by the actinorhodin minimal polyketide synthase. (Biochemistry. , 2007)

close this sectionPKS/NRPS Module

CLF20..382

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [AlnM ketoacyl synthase beta]
MTLATPAAQETPERTGRPTAVITGIGVAAPNGLGTEQWWQSTLQGTSGIGPVVDYDASRY
PSRLVGRIDGFEAAEHIPGRLLPQTDRVTRLALVAGAEALADADANPAELAEQDGYGEYG
CGVVTSNATGGFEFTHREIRKLWTQGPQQVSVYESFAWFYAVNTGQLSIRHKLRGPSGVL
VSEQAGGLDAIGQSRRTLRQGVKLSLTGGMDSSLDPWGLVSHLASGRLSRSDDPATAYLP
FDTRAAGQVPGEGGAMLVLEEETAARARGARVYGEIAGYAATFSPRPGSGRPPGLERAAR
LALADSGLGVEDVDVVFADAAGLPTADDEEAAALRALFGPYGVPVTAPKTLTGRLFGGGA
PLDVAAALLALRDGVIPPTAGIDRPVPEHRLDLVRGTPRHTPLRTALVLARGHGGFNAAV
VVRAPEAA
selected fasta
>polyketide synthase chain length factor subunit [AlnM ketoacyl synthase beta]
ATGACACTGGCCACTCCCGCGGCCCAGGAGACCCCTGAGCGCACCGGGCGGCCGACCGCC
GTCATCACCGGCATCGGTGTCGCCGCCCCCAACGGCCTCGGCACCGAGCAGTGGTGGCAG
TCCACGCTGCAGGGCACGAGCGGTATCGGGCCGGTCGTCGACTACGACGCCTCCCGCTAC
CCGTCCCGGCTGGTCGGGCGGATCGACGGGTTCGAGGCGGCCGAGCACATCCCGGGACGG
CTGCTGCCGCAGACCGACCGGGTGACCCGGCTGGCCCTCGTCGCGGGCGCCGAGGCACTG
GCCGACGCCGACGCCAACCCCGCCGAACTGGCGGAACAGGACGGATACGGCGAGTACGGC
TGCGGCGTGGTCACCTCGAACGCCACCGGTGGATTCGAGTTCACCCACCGGGAGATCCGC
AAACTGTGGACCCAGGGCCCGCAGCAGGTCAGCGTCTACGAGTCCTTCGCCTGGTTCTAC
GCGGTCAACACAGGCCAGCTCTCCATCCGCCACAAGCTGCGCGGACCCAGTGGCGTCCTC
GTCTCCGAACAGGCGGGCGGCCTCGATGCCATCGGCCAGTCCCGCCGCACGCTGCGGCAG
GGCGTCAAGCTCTCGCTGACCGGCGGCATGGACTCCTCCCTCGACCCCTGGGGGCTCGTC
TCCCACCTCGCGAGCGGCCGGCTCTCCCGCTCCGACGACCCCGCCACCGCCTACCTGCCC
TTCGACACCCGCGCCGCCGGTCAAGTGCCGGGCGAGGGAGGCGCGATGCTCGTACTCGAA
GAGGAGACGGCGGCCCGTGCGCGGGGCGCCCGGGTGTACGGCGAGATCGCCGGATACGCG
GCCACCTTCTCGCCGCGGCCGGGCTCCGGACGCCCGCCCGGTCTCGAACGCGCCGCACGG
CTCGCCCTCGCCGACAGCGGGCTGGGTGTCGAGGACGTGGACGTGGTCTTCGCCGACGCC
GCGGGACTGCCCACGGCCGACGACGAGGAGGCCGCGGCACTGCGCGCCCTCTTCGGCCCC
TACGGCGTGCCGGTCACCGCCCCCAAGACCCTCACGGGCCGGCTCTTCGGCGGTGGGGCC
CCGCTCGACGTGGCCGCGGCCCTGCTCGCCCTGCGCGACGGTGTCATCCCGCCCACCGCG
GGCATCGACCGCCCCGTTCCCGAGCACCGGCTCGACCTGGTGCGCGGCACACCCCGCCAC
ACCCCGCTGCGTACCGCCCTGGTGCTGGCGCGGGGTCATGGCGGCTTCAACGCCGCCGTG
GTGGTCCGCGCGCCAGAGGCCGCCTGA
CLF20..382
CLF58..1146

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [20-264]  1.29999999999998e-48 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [273-382]  7.90000000000001e-24 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [20-278]  3.40000000000004e-52 G3DSA:3.40.47.10 [290-425]  2.80000000000001e-37 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [17-270]  2.90000354677981e-57 SSF53901 [233-425]  2.50000909916183e-49 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit