close all open/close all

CDS information : Alnu_00080


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction6,116 / 6,370 / + [in whole cluster]
6,116 / 6,370 / + [in contig]
Location6116..6370 [in whole cluster]
6116..6370 [in contig]
TypeCDS
Length255 bp (84 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)AlnN acyl carrier protein
Gene
Gene (GenBank)alnN
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q54996
NITE
Fren_00140
PmId
[8468280] Genetic construction and functional analysis of hybrid polyketide synthases containing heterologous acyl carrier proteins. (J Bacteriol. , 1993)
[7972098] Engineered biosynthesis of novel polyketides: influence of a downstream enzyme on the catalytic specificity of a minimal aromatic polyketide synthase. (Proc Natl Acad Sci U S A. , 1994)
[12705828] Solution structure and backbone dynamics of the holo form of the frenolicin acyl carrier protein. (Biochemistry. , 2003)

close this sectionPKS/NRPS Module

ACP4..77

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [AlnN acyl carrier protein]
MTITLDDLVLVLTECAGADDDVTLTGQNLDVPFTDLGYDSLALLETAALMKQRFAVDLTD
EEVTGIETPREFLDRVNHAAAQAA
selected fasta
>polyketide synthase acyl carrier protein subunit [AlnN acyl carrier protein]
ATGACCATCACCCTCGACGACCTGGTCCTCGTGCTCACCGAGTGCGCGGGCGCCGACGAC
GACGTCACGCTCACCGGCCAGAACCTGGACGTGCCCTTCACCGACCTCGGCTACGACTCG
CTGGCGCTGCTGGAGACGGCGGCCCTGATGAAGCAGCGGTTCGCGGTCGACCTCACCGAC
GAGGAGGTCACCGGGATAGAGACCCCCCGGGAGTTCCTCGACCGGGTCAACCACGCCGCG
GCCCAGGCCGCCTGA
ACP4..77
ACP10..231

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [35-50]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [4-77]  PS50075
PS50075   ACP_DOMAIN
 [1-79]  7.09999884211141e-11 SSF47336
SSF47336   ACP_like
 [4-79]  9e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [18-76]  1.1e-08 PF00550
PF00550   PP-binding
SignalP
 [1-18]  0.09 Signal
Bacteria, Gram-negative   
 [1-18]  0.404 Signal
Eukaryota   
TMHMM No significant hit