close all open/close all

CDS information : Alnu_00090


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction6,389 / 7,180 / + [in whole cluster]
6,389 / 7,180 / + [in contig]
Location6389..7180 [in whole cluster]
6389..7180 [in contig]
TypeCDS
Length792 bp (263 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)AlnP ketoreductase
Gene
Gene (GenBank)alnP
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q8VWB5
PmId
[8157619] Nucleotide sequence of the aknA region of the aklavinone biosynthetic gene cluster of Streptomyces galilaeus. (J Bacteriol. , 1994)
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)
ACC
Q54812
NITE
Adria_00250
PmId
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)
ACC
P16544
NITE
Actino_00170
PmId
[2394677] Biosynthesis of anthraquinones by interspecies cloning of actinorhodin biosynthesis genes in streptomycetes: clarification of actinorhodin gene functions. (J Bacteriol. , 1990)
[15458634] The crystal structure of the actIII actinorhodin polyketide reductase: proposed mechanism for ACP and polyketide binding. (Structure. , 2004)
[18205400] Inhibition kinetics and emodin cocrystal structure of a type II polyketide ketoreductase. (Biochemistry. , 2008)
[18691223] Localization of the ActIII actinorhodin polyketide ketoreductase to the cell wall. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [AlnP ketoreductase]
MEQVQAPRGTAVVTGATRGIGRSVAASLGALGHPVYLCARDEEALTQTVKELQESGVTAD
GTVCDVTSAESVQRFVQSAVDRFGPVEVLVNNAGRSGGGVTAEIPDELWFDVINTNLNSV
FLVTKQVLTTGRMRELKRARIVSIASTGGKQGVVFGAPYSASKHGVVGFTKALGLELAKS
GITVNAVCPGYVETPMAGNVRQHYARIWNTTEDEVLERFNAKIPLGRYTDPDEVAAMVAY
LVSDAAAAVTAQAINVCGGLGNY
selected fasta
>putative polyketide C-9 ketoreductase [AlnP ketoreductase]
ATGGAGCAGGTACAGGCCCCCCGGGGCACCGCCGTCGTCACCGGAGCGACCCGGGGCATC
GGACGGTCCGTCGCGGCCTCCCTGGGCGCGCTCGGACACCCCGTCTACCTCTGCGCCCGG
GACGAGGAAGCCCTCACCCAGACCGTCAAGGAGCTCCAGGAGAGCGGTGTGACGGCAGAC
GGAACCGTGTGCGACGTGACCTCGGCCGAGAGCGTGCAGCGGTTCGTCCAGTCCGCCGTC
GACCGGTTCGGTCCCGTTGAGGTCCTGGTGAACAACGCCGGGCGCAGCGGTGGCGGCGTC
ACCGCCGAGATCCCCGACGAGCTCTGGTTCGACGTCATCAACACCAACCTCAACAGCGTC
TTCCTGGTCACCAAGCAGGTGCTGACCACCGGCCGGATGCGTGAGCTGAAGCGCGCCAGG
ATCGTCAGCATCGCCTCCACGGGCGGCAAGCAGGGCGTCGTGTTCGGGGCGCCCTACTCG
GCCTCCAAGCACGGCGTGGTCGGGTTCACCAAGGCCCTCGGCCTCGAACTGGCCAAGAGC
GGAATCACCGTCAACGCGGTCTGCCCCGGCTATGTGGAGACGCCCATGGCGGGCAACGTG
CGCCAGCACTACGCCCGTATCTGGAACACCACCGAGGACGAGGTCCTGGAGCGGTTCAAC
GCCAAGATCCCCCTCGGCCGCTACACCGACCCCGACGAGGTCGCCGCCATGGTGGCGTAT
CTCGTCTCGGACGCGGCGGCGGCCGTCACCGCGCAGGCGATCAACGTCTGCGGAGGCCTC
GGAAACTACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1-235]  3.89999861795218e-16 PIRSF000126
PIRSF000126   11-beta-HSD1
 [9-177]  3.89999999999997e-33 PF00106
PF00106   adh_short
 [84-95]  1.49999977583352e-11 PR00080 [139-147]  1.49999977583352e-11 PR00080 [159-178]  1.49999977583352e-11 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [10-27]  4.69998262513195e-44 PR00081 [84-95]  4.69998262513195e-44 PR00081 [133-149]  4.69998262513195e-44 PR00081 [159-178]  4.69998262513195e-44 PR00081 [180-197]  4.69998262513195e-44 PR00081 [224-244]  4.69998262513195e-44 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [9-260]  4.49999999999996e-80 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [146-174]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-39]  0.354 Signal
Bacteria, Gram-positive   
 [1-25]  0.218 Signal
Bacteria, Gram-negative   
TMHMM No significant hit