close all open/close all

CDS information : Alnu_00100


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction7,238 / 8,233 / + [in whole cluster]
7,238 / 8,233 / + [in contig]
Location7238..8233 [in whole cluster]
7238..8233 [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)AlnQ aromatase
Gene
Gene (GenBank)alnQ
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q02055
NITE
Actino_00210
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [AlnQ aromatase]
MDTETHERTADSPTRSAEHVTELAASARRAYALIEDVGRWPLLFAPCIWSQELERTGGIQ
RIRLWAVVGNGVRSWTSRRVLDPAGNRIDFAQETPAAPITEMSGHWRFQDASPGSPGRLE
LGHRWTTDGEPGAADRIAAALDSNSTVEIGALRAWAERPEEPDELILSFSDEELIAAPAA
EVYDFLYRADLWPERLPHVAGLDLESNPAEPATAGAEVQTMDMETSAADGSTHTTQSVRL
CFEGERIVYKQTTPPRGLLAHSGEWLFSSGPEGTLVTARHTVALDPAAVESVFGPGTTIA
QALLRARDIIGANSRGTLRTARSHLEQGAAE
selected fasta
>putative cyclase/dehydratase [AlnQ aromatase]
GTGGACACGGAGACGCACGAGAGGACCGCGGACAGCCCCACCCGTTCCGCCGAGCACGTG
ACCGAGCTGGCCGCGTCGGCCCGCCGCGCCTACGCGCTCATCGAGGACGTCGGCCGCTGG
CCGCTGCTCTTCGCGCCCTGCATCTGGTCCCAGGAACTGGAACGCACCGGCGGCATCCAG
CGCATCCGGCTCTGGGCGGTCGTCGGCAACGGGGTGCGCAGCTGGACCTCGCGGAGGGTG
CTCGACCCGGCGGGCAACCGGATCGACTTCGCCCAGGAGACCCCGGCCGCGCCGATCACG
GAGATGTCGGGTCACTGGCGGTTCCAGGACGCCTCGCCCGGCAGCCCCGGGCGGCTGGAA
CTCGGACACCGGTGGACCACCGACGGCGAACCGGGCGCGGCCGACCGCATCGCCGCCGCG
CTGGACTCCAACAGCACCGTCGAGATCGGGGCACTCCGGGCCTGGGCGGAACGCCCCGAG
GAGCCGGACGAGTTGATCCTGAGCTTCAGCGACGAGGAGCTCATAGCCGCGCCGGCCGCG
GAGGTCTACGACTTCCTGTACCGCGCCGATCTGTGGCCCGAGCGGCTGCCGCACGTGGCC
GGGCTCGACCTGGAGAGCAACCCGGCGGAGCCCGCCACCGCGGGCGCCGAGGTGCAGACG
ATGGACATGGAGACCTCCGCCGCCGACGGGAGTACGCACACCACCCAGTCGGTGCGGCTG
TGCTTCGAGGGCGAGCGGATCGTCTACAAACAGACCACCCCGCCGCGCGGGCTGCTGGCG
CACTCCGGAGAGTGGCTCTTCAGCAGTGGCCCTGAGGGCACCCTGGTCACCGCCCGGCAC
ACGGTGGCCCTCGATCCCGCCGCGGTGGAGAGCGTCTTCGGACCGGGCACCACCATCGCC
CAGGCCCTCCTCAGGGCCCGGGACATCATCGGCGCCAACAGCCGGGGCACCCTTCGGACG
GCCCGGAGCCACCTCGAGCAGGGGGCTGCCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [24-125]  8.3e-08 PF03364
PF03364   Polyketide_cyc
IPR019587 Polyketide cyclase/dehydrase (Family)
 [169-296]  2.7e-07 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [22-113]  9.60000000000001e-14 G3DSA:3.30.530.20 [169-295]  9.60000000000001e-14 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-32]  0.048 Signal
Eukaryota   
TMHMM No significant hit