close all open/close all

CDS information : Alnu_00110


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction8,245 / 9,180 / + [in whole cluster]
8,245 / 9,180 / + [in contig]
Location8245..9180 [in whole cluster]
8245..9180 [in contig]
TypeCDS
Length936 bp (311 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)AlnR cyclase
Gene
Gene (GenBank)alnR
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q9X466
NITE
Naphcy_00060
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
ACC
Q93IZ0
NITE
Actino_00220
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [AlnR cyclase]
MTGDRTAAPGRLEELADGVFAYIQPDGGWCVSNAGILLEPGRGGGPVLVDTAATQERARA
MRAALGGLTPESPRLIVNTHFHGDHTFGNAVLAGPGTVVVAHERTRTEMAAAGLGLTTLW
PDVEWGGIELMLPDLTYRQGLTLHQGERRIELIHPGPAHTTNDTLVWLPEERVLFAGDVV
LPGCTPFVLMGSVAGSLAALELLRKLDPLTVVGGHGPVSGPEALTRTEEYFHWLTELAAK
GRAAGLTPLQLARETGPGPYGDLRDPERLPANLHRAYSELAGEELGHALDVVSVFGEMVE
YNGGVLPLSHA
selected fasta
>putative cyclase/dehydratase [AlnR cyclase]
GTGACCGGGGACCGGACCGCCGCCCCGGGAAGGCTGGAAGAGCTGGCGGACGGTGTGTTC
GCGTACATCCAGCCCGACGGCGGCTGGTGCGTCAGCAACGCGGGCATCCTGCTGGAACCG
GGGCGGGGTGGCGGACCCGTGCTGGTGGACACGGCCGCCACCCAGGAGCGGGCGCGGGCC
ATGCGGGCCGCCCTCGGCGGGCTCACGCCCGAGTCCCCGCGGCTGATCGTCAACACCCAT
TTCCACGGCGACCACACCTTCGGCAACGCCGTACTGGCGGGCCCGGGCACCGTCGTCGTC
GCGCACGAGCGCACCCGTACGGAGATGGCGGCAGCCGGACTCGGTCTGACCACGCTGTGG
CCCGACGTCGAGTGGGGCGGCATCGAGCTGATGCTGCCCGACCTGACGTACCGCCAGGGG
CTCACCCTCCACCAGGGGGAGCGCCGGATCGAGCTGATCCATCCGGGCCCCGCGCACACC
ACCAACGACACGCTGGTGTGGCTGCCCGAGGAGCGCGTGCTGTTCGCCGGCGACGTCGTG
CTTCCCGGCTGTACGCCGTTCGTACTGATGGGGTCCGTCGCCGGGTCCCTCGCCGCCCTG
GAACTCCTGCGGAAGCTGGACCCGCTGACCGTCGTCGGCGGCCACGGCCCCGTCAGCGGC
CCCGAGGCGCTGACCCGGACCGAGGAGTACTTCCACTGGCTGACGGAGCTCGCCGCCAAG
GGCAGGGCGGCGGGGCTCACCCCCCTCCAACTCGCCCGCGAGACGGGGCCCGGCCCGTAC
GGCGACCTGCGCGATCCCGAGCGGCTGCCGGCCAACCTGCACCGCGCCTACTCGGAACTG
GCCGGCGAAGAGCTCGGCCATGCCCTCGACGTCGTGTCGGTCTTCGGCGAGATGGTCGAG
TACAACGGCGGAGTACTTCCCCTCTCCCACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [33-215]  1.1e-21 PF00753
PF00753   Lactamase_B
 [32-215]  1.79999754022375e-29 SM00849
SM00849   Lactamase_B
SignalP No significant hit
TMHMM No significant hit