close all open/close all

CDS information : Alnu_00130


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction11,277 / 10,681 / - [in whole cluster]
11,277 / 10,681 / - [in contig]
Locationcomplement(10681..11277) [in whole cluster]
complement(10681..11277) [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)AlnR2 TetR family regulator
Gene
Gene (GenBank)alnR2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [AlnR2 TetR family regulator]
MLTAMAAAPSERADAVRNRQKILAAAARLVAAGAAERLSLDEVARVADVGVGTVYRRFGD
RAGLVFALLEEQHQLFRARVVEGPPPLGPGADAGDRLRAFLHALVDLSVGQRELLLLAES
SSPPARYLSASYDFQHAHAGRLIAELRPDADADFLADALLAPFAPSLIDHQCRVRGFSPE
RIKAGFDQLVRSTPESAR
selected fasta
>putative TetR family transcriptional regulator [AlnR2 TetR family regulator]
ATGCTCACCGCCATGGCCGCAGCCCCCTCCGAACGCGCCGACGCGGTGCGCAACCGACAG
AAGATCCTGGCCGCGGCAGCCCGTCTGGTGGCCGCCGGAGCGGCGGAGCGGCTCTCCCTC
GACGAGGTCGCCCGGGTGGCGGACGTGGGCGTGGGCACGGTCTACCGCCGCTTCGGCGAC
CGCGCCGGACTGGTCTTCGCGCTCCTGGAGGAACAGCACCAGCTGTTCCGGGCCCGGGTG
GTGGAGGGCCCGCCCCCCTTGGGGCCGGGGGCCGACGCCGGTGACCGGCTGCGCGCCTTC
CTGCACGCGCTCGTCGACCTCTCCGTCGGACAGCGGGAACTGCTGCTGCTCGCCGAGTCC
AGTTCGCCGCCCGCGCGTTACCTCAGCGCCTCCTACGACTTTCAGCACGCGCACGCCGGC
CGGCTGATCGCCGAGCTGCGCCCGGACGCCGACGCGGACTTTCTGGCGGACGCGCTGCTG
GCCCCCTTCGCACCCAGCCTGATCGACCACCAGTGCCGGGTCAGGGGCTTCTCACCGGAG
CGGATCAAGGCCGGCTTCGACCAGCTCGTGCGCAGCACGCCGGAGTCGGCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [22-68]  4.00000000000001e-09 PF00440
PF00440   TetR_N
 [16-76]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [14-92]  5.90000104995095e-14 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [91-196]  1.19999985703101e-06 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [12-180]  1.2e-28 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP
 [1-35]  0.639 Signal
Eukaryota   
TMHMM No significant hit