close all open/close all

CDS information : Alnu_00140


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction11,401 / 11,868 / + [in whole cluster]
11,401 / 11,868 / + [in contig]
Location11401..11868 [in whole cluster]
11401..11868 [in contig]
TypeCDS
Length468 bp (155 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)Aln3
Gene
Gene (GenBank)aln3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
Related Reference
ACC
P71854
PmId
[16387854] Identification of a nitroimidazo-oxazine-specific protein involved in PA-824 resistance in Mycobacterium tuberculosis. (Proc Natl Acad Sci U S A. , 2006)
Family/Domain
FD
IPR004378

close this sectionSequence

selected fasta
>putative oxidoreductase [Aln3]
MAADQFDPAPTTPAEGDPGSYNLPVMQEFRQNGGKVGGPFEGGSLILLTTKGAKSGVVRT
VPTLFFAQSDGSLLIFGSNGGADTHPAWFHNIRVNPRVTVETGEETYSAVATEVPAGSEE
RDRLFAEAAAEVQAFAAYQAQTERKIPLVILSRKD
selected fasta
>putative oxidoreductase [Aln3]
GTGGCTGCTGACCAGTTCGACCCCGCGCCCACCACCCCCGCCGAAGGAGACCCGGGCAGC
TACAACCTCCCGGTCATGCAGGAGTTCCGGCAGAACGGCGGCAAGGTCGGCGGTCCCTTC
GAAGGCGGTTCGCTCATCCTGCTCACCACCAAGGGGGCGAAGTCCGGCGTGGTGCGCACG
GTGCCCACCCTCTTCTTCGCCCAGTCCGACGGTAGCCTGCTGATCTTCGGCAGCAACGGC
GGCGCGGACACCCACCCCGCCTGGTTCCACAACATCAGGGTCAATCCCCGGGTGACCGTC
GAGACCGGCGAGGAGACCTACTCGGCCGTCGCGACCGAGGTGCCGGCCGGGAGCGAGGAG
CGCGACCGCCTCTTCGCCGAGGCCGCCGCCGAGGTGCAGGCCTTCGCCGCCTACCAGGCC
CAGACTGAGCGGAAGATCCCCCTGGTCATACTGAGCCGGAAGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004378 Deazaflavin-dependent nitroreductase (Family)
 [38-151]  4.5e-24 TIGR00026
TIGR00026   Hi_GC_TIGR00026
 [27-151]  1.5e-30 PF04075
PF04075   DUF385
SignalP No significant hit
TMHMM No significant hit