close all open/close all

CDS information : Alnu_00150


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction11,872 / 12,936 / + [in whole cluster]
11,872 / 12,936 / + [in contig]
Location11872..12936 [in whole cluster]
11872..12936 [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNADPH-dependent oxidoreductase
Product (GenBank)Aln4 ketoreductase
Gene
Gene (GenBank)aln4
EC number
Keyword
  • dioxane moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
Related Reference
ACC
Q9XC70
PmId
[16448097] A two-stage one-pot enzymatic synthesis of TDP-L-mycarose from thymidine and glucose-1-phosphate. (J Am Chem Soc. , 2006)

close this sectionSequence

selected fasta
>NADPH-dependent oxidoreductase [Aln4 ketoreductase]
MRYTLLGRTGVRISRLALGTMTFGDDWKLPEATRARIFDQYAEAGGNFIDTADEYGDGSA
ETTLGKLLAGRRDEFVLSTKYTMQRRPGDLNSAGNHRKNLVRSLEASLRRLGTDHVDMLW
VHARDTLTPVPEVMRALDDQVRAGKVLYVGVSDWPAWEVAQANTLAELRDWSPFAGLQIR
YNLLERTVERELLPMAHAFDLPVFAWGPLADGRLTGKYLRSEEGRLDHVAWGQGGTGPGD
DVVEETVRVAEAAGVSPAQVALAWLLSRPANVVPILGATKPEQLADNLGAVEAVLQDDWL
AGLERVSRVEPGFPHDFLRFPAMRDAIYGDRWQQVDDLRTTARRVPADDRYGAA
selected fasta
>NADPH-dependent oxidoreductase [Aln4 ketoreductase]
GTGCGCTACACGCTTCTCGGCAGGACCGGGGTCCGGATATCCCGGCTGGCACTGGGCACC
ATGACCTTCGGCGACGACTGGAAGCTCCCCGAGGCGACACGCGCGCGGATCTTCGACCAG
TACGCCGAGGCCGGCGGCAACTTCATCGACACCGCCGACGAGTACGGCGACGGATCGGCG
GAGACGACGCTCGGCAAGCTGCTCGCCGGACGCCGCGACGAGTTCGTCCTCAGCACCAAG
TACACGATGCAGAGGCGGCCGGGTGACCTGAACTCCGCGGGCAACCACCGCAAGAACCTG
GTGCGTTCCCTGGAGGCGAGCCTGCGCCGGCTCGGCACGGACCACGTGGACATGCTGTGG
GTGCACGCCCGAGACACCCTCACCCCGGTGCCCGAGGTGATGAGGGCGCTGGACGACCAG
GTGCGCGCGGGCAAGGTCCTCTACGTCGGTGTGTCCGACTGGCCCGCGTGGGAGGTGGCC
CAGGCCAACACCCTGGCCGAACTGCGTGACTGGTCGCCCTTCGCGGGACTGCAGATCAGG
TACAACCTGCTGGAGCGCACCGTCGAGCGTGAACTCCTGCCGATGGCCCACGCCTTCGAC
CTTCCGGTGTTCGCCTGGGGCCCGCTGGCCGACGGGCGGCTCACCGGCAAGTACCTGCGG
TCCGAGGAGGGGCGCCTGGACCACGTGGCCTGGGGGCAGGGCGGCACCGGCCCCGGCGAC
GACGTCGTCGAGGAGACCGTGCGGGTCGCCGAGGCCGCCGGAGTCAGCCCCGCCCAGGTG
GCGCTGGCCTGGCTGCTGTCCCGGCCCGCAAACGTCGTGCCGATCCTCGGCGCCACCAAG
CCCGAGCAGCTCGCCGACAACCTGGGGGCCGTCGAAGCCGTGCTGCAGGACGACTGGCTG
GCGGGCCTCGAACGGGTCAGCCGCGTGGAGCCGGGCTTCCCGCACGACTTCCTGCGCTTC
CCGGCCATGCGGGACGCCATCTACGGCGACCGCTGGCAGCAGGTCGACGACCTGCGGACG
ACCGCGCGACGGGTCCCGGCCGACGACCGGTACGGGGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR023210 NADP-dependent oxidoreductase domain (Domain)
 [1-306]  3.89999861795218e-89 SSF51430
SSF51430   Aldo/ket_red
 [1-307]  1.5e-87 G3DSA:3.20.20.100
G3DSA:3.20.20.100   Aldo/ket_red
 [15-305]  1.10000000000001e-68 PF00248
PF00248   Aldo_ket_red
SignalP
 [1-19]  0.47 Signal
Eukaryota   
TMHMM No significant hit