close all open/close all

CDS information : Alnu_00160


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction13,510 / 13,052 / - [in whole cluster]
13,510 / 13,052 / - [in contig]
Locationcomplement(13052..13510) [in whole cluster]
complement(13052..13510) [in contig]
TypeCDS
Length459 bp (152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein
Product (GenBank)AlnO
Gene
Gene (GenBank)alnO
EC number
Keyword
  • coenzyme F420
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
O52559
NITE
Rifam_00390
PmId
[16079331] Identification of tailoring genes involved in the modification of the polyketide backbone of rifamycin B by Amycolatopsis mediterranei S699. (Microbiology. , 2005)
Family/Domain
FD
IPR011576

close this sectionSequence

selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [AlnO]
MPNYVDAPEGWWREFIMADPPRTAKASVVRKDGSPHVVPVGVIMDGDDIIYTCQKDSVKG
RSLQRDGRIAMLWDDERPPFSFVLVRGRATLSEDLDELRAWTARIGGRYHGKRREEEFSE
RFTIPNGVVVRVKVEQIVAKVNLSETVNVKDA
selected fasta
>pyridoxamine 5'-phosphate oxidase-like FMN-binding domain protein [AlnO]
ATGCCCAACTACGTGGACGCGCCCGAGGGTTGGTGGCGGGAGTTCATCATGGCCGATCCG
CCCAGGACCGCGAAGGCCTCGGTGGTCCGCAAGGACGGCAGTCCCCATGTCGTCCCGGTC
GGAGTCATCATGGACGGCGACGACATCATCTACACGTGCCAGAAGGACAGCGTGAAGGGC
CGCTCCCTGCAACGGGACGGCAGGATCGCGATGCTGTGGGACGACGAGCGCCCGCCGTTC
TCGTTCGTGCTGGTGCGCGGGCGGGCGACGCTCAGCGAGGACCTCGACGAACTGCGCGCC
TGGACCGCCCGGATCGGCGGCCGGTACCACGGCAAGCGGCGCGAGGAGGAGTTCTCCGAG
CGGTTCACCATCCCCAACGGCGTCGTGGTCCGGGTGAAGGTGGAACAGATCGTCGCCAAG
GTGAATCTGTCGGAGACCGTGAACGTGAAGGACGCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009002 FMN-binding split barrel-related (Domain)
 [17-140]  6.69999687625999e-20 SSF50475
SSF50475   FMN_binding
IPR011576 Pyridoxamine 5'-phosphate oxidase-like, FMN-binding domain (Domain)
 [27-94]  1.9e-11 PF01243
PF01243   Pyridox_oxidase
IPR012349 FMN-binding split barrel (Domain)
 [11-140]  4.70000000000001e-28 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
IPR019920 F420-binding domain, putative (Domain)
 [18-138]  5.30000000000001e-27 TIGR03618
TIGR03618   Rv1155_F420
SignalP
 [1-26]  0.139 Signal
Eukaryota   
 [1-26]  0.208 Signal
Bacteria, Gram-positive   
 [1-26]  0.051 Signal
Bacteria, Gram-negative   
TMHMM No significant hit