close all open/close all

CDS information : Alnu_00170


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction14,040 / 13,510 / - [in whole cluster]
14,040 / 13,510 / - [in contig]
Locationcomplement(13510..14040) [in whole cluster]
complement(13510..14040) [in contig]
TypeCDS
Length531 bp (176 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)Aln5
Gene
Gene (GenBank)aln5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [Aln5]
MTPEEVVGVWRLASYTEVGEDGGTVAGPLGEAPAGLLIYTADGHVAVSMMKTGDAPALET
YMGYSGQWRLAGDRMTHRVQVSAHPRMAGTEQIRRVALDGETLSLRGTAVTPVGGRAPER
VLTWRRAKPEGIAADGTASGSTAFDGTGSGGTAFDSTAFDSTASDETAEQQEKETH
selected fasta
>hypothetical protein [Aln5]
GTGACGCCGGAGGAGGTCGTCGGAGTGTGGCGGCTGGCCTCGTACACGGAGGTGGGCGAG
GACGGGGGCACGGTGGCGGGGCCGTTGGGCGAGGCGCCGGCCGGGCTGCTGATCTACACC
GCGGACGGGCATGTCGCGGTGAGCATGATGAAGACCGGGGACGCCCCGGCCCTGGAGACC
TACATGGGCTACTCGGGGCAGTGGCGGCTGGCCGGGGACCGGATGACGCACCGGGTCCAG
GTCAGCGCCCATCCGCGGATGGCGGGCACCGAGCAGATACGCCGCGTCGCGCTCGACGGC
GAAACGCTGTCGCTGCGCGGCACGGCCGTGACACCGGTGGGGGGCCGCGCGCCGGAACGC
GTACTCACCTGGCGGCGCGCGAAGCCGGAAGGCATCGCGGCCGACGGCACGGCATCCGGC
AGCACGGCGTTCGACGGCACGGGATCCGGCGGCACGGCGTTCGACAGCACAGCTTTCGAC
AGCACGGCGTCCGACGAGACGGCGGAACAGCAGGAGAAGGAGACGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR024311 Lipocalin-like domain (Domain)
 [7-127]  6.1e-31 PF13924
PF13924   Lipocalin_5
SignalP No significant hit
TMHMM No significant hit