close all open/close all

CDS information : Alnu_00180


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction15,116 / 14,037 / - [in whole cluster]
15,116 / 14,037 / - [in contig]
Locationcomplement(14037..15116) [in whole cluster]
complement(14037..15116) [in contig]
TypeCDS
Length1,080 bp (359 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productoxidase
Product (GenBank)Aln6
Gene
Gene (GenBank)aln6
EC number
Keyword
  • dioxan moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
Related Reference
ACC
Q93IZ2
NITE
Actino_00090
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)

close this sectionSequence

selected fasta
>oxidase [Aln6]
MPRRTFVSRHGLLLAAAALGTVMTTPGTSTAKPGSRGYRMVWDDFADGFRTEGEGARWFH
VAGGPYRADDGIVATRRGELSVRARGSHPATGEPAFTQTIPAENPVGMPGSGDHAKFIAY
TSHTASSGHPGFDAHEGYELLFETRLSGRTYGTADHPFGDAVRDPEDDLRLASAMMLTTD
PETSVSFDFVVTNKRIYAWYGRPTFLRGQLGDYASFAHTVPLVARKPGDSHDFGIAYDRA
AGVVRWLIDGEEHFRVDRIGHRLDRSTATLDEGGEETLVRPRQLNAGLGLLTLLDASWPT
DKGLVRLSARKHTTYYRPSVGAPQEQTFADEDSTDAGRLFGQGAAVRLGSYRVTSRRSR
selected fasta
>oxidase [Aln6]
ATGCCGCGCAGAACGTTCGTCTCCCGGCACGGCCTGCTGCTCGCCGCCGCCGCGCTGGGC
ACCGTCATGACGACACCGGGGACCTCCACCGCCAAACCGGGCAGCCGTGGCTACCGGATG
GTCTGGGACGACTTCGCCGACGGGTTCCGCACCGAGGGCGAGGGCGCCCGGTGGTTCCAC
GTGGCGGGCGGTCCCTACCGTGCCGACGACGGCATCGTCGCCACCCGCCGGGGCGAGCTG
TCCGTGCGGGCACGTGGCAGTCACCCCGCGACCGGCGAGCCGGCGTTCACGCAGACCATC
CCCGCCGAGAACCCGGTCGGCATGCCGGGCTCAGGGGACCACGCCAAGTTCATCGCGTAC
ACCAGTCACACGGCCTCCAGCGGCCACCCGGGGTTCGACGCCCACGAGGGCTACGAGCTC
CTCTTCGAGACGCGGCTCTCCGGTAGGACCTACGGCACCGCGGACCACCCCTTCGGGGAC
GCGGTGCGGGATCCGGAGGACGATCTGCGGCTGGCCTCCGCGATGATGCTGACCACCGAC
CCGGAGACCTCCGTCTCCTTCGACTTCGTGGTCACCAACAAGCGGATCTACGCCTGGTAC
GGGCGCCCCACCTTCCTGCGCGGCCAGTTGGGCGACTACGCCTCGTTCGCGCACACTGTG
CCGCTGGTCGCGAGGAAGCCCGGCGACAGCCACGACTTCGGCATCGCCTACGACCGCGCC
GCCGGTGTGGTGCGCTGGCTCATCGACGGCGAGGAGCACTTCCGGGTGGACCGCATCGGA
CACCGGCTCGACCGGTCCACCGCGACCCTGGACGAGGGCGGCGAGGAGACGCTGGTCAGG
CCGAGGCAGCTCAACGCCGGGCTGGGACTGCTGACCCTGCTGGACGCGTCCTGGCCCACC
GACAAGGGCCTCGTACGGCTCTCCGCGCGCAAGCACACCACGTACTACCGGCCCTCGGTC
GGTGCCCCGCAGGAGCAGACCTTCGCCGACGAGGACAGCACCGACGCCGGGCGGCTCTTC
GGGCAGGGCGCGGCCGTGCGGCTCGGCTCCTACCGCGTGACCAGCAGGCGCTCGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-31]  1 Signal
Bacteria, Gram-positive   
 [1-31]  1 Signal
Bacteria, Gram-negative   
 [1-31]  0.998 Signal
Eukaryota   
TMHMM No significant hit