close all open/close all

CDS information : Alnu_00190


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction15,880 / 15,197 / - [in whole cluster]
15,880 / 15,197 / - [in contig]
Locationcomplement(15197..15880) [in whole cluster]
complement(15197..15880) [in contig]
TypeCDS
Length684 bp (227 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productphosphatase
Product (GenBank)AlnB
Gene
Gene (GenBank)alnB
EC number
Keyword
  • dioxan moiety
  • C-ribosylation
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
[23297194] Structural basis for C-ribosylation in the alnumycin A biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2013)
[24015959] Chemoenzymatic synthesis of novel C-ribosylated naphthoquinones. (ACS Chem Biol. , 2013)
Related Reference
ACC
D6B644
PmId
[25081867] Molecular evolution of the bacterial pseudouridine-5'-phosphate glycosidase protein family. (FEBS J. , 2014)

close this sectionSequence

selected fasta
>phosphatase [AlnB]
MSGAPAAADRGVILDLDGTLADTPAAIATITAEVLAAMGTAVSRGAILSTVGRPLPASLA
GLLGVPVEDPRVAEATEEYGRRFGAHVRAAGPRLLYPGVLEGLDRLSAAGFRLAMATSKV
EKAARAIAELTGLDTRLTVIAGDDSVERGKPHPDMALHVARGLGIPPERCVVIGDGVPDA
EMGRAAGMTVIGVSYGVSGPDELMRAGADTVVDSFPAAVTAVLDGHP
selected fasta
>phosphatase [AlnB]
GTGAGCGGCGCCCCCGCCGCGGCAGACCGTGGTGTGATCCTCGACCTCGACGGCACACTC
GCGGACACCCCCGCCGCCATCGCCACCATCACCGCCGAGGTCCTGGCGGCGATGGGCACG
GCGGTGTCCCGAGGGGCGATCCTCTCCACGGTCGGCCGGCCGCTGCCGGCCTCTCTCGCC
GGTCTGCTGGGCGTTCCCGTGGAGGACCCGCGGGTGGCCGAGGCGACCGAGGAGTACGGG
CGGCGGTTCGGCGCCCATGTGCGGGCGGCCGGGCCGCGGTTGCTGTATCCCGGGGTCCTC
GAAGGGCTGGACCGGCTGTCCGCCGCCGGTTTCCGGCTGGCCATGGCGACCTCGAAGGTC
GAGAAGGCCGCGCGCGCCATCGCCGAACTCACCGGTCTGGACACCCGGCTGACGGTCATC
GCGGGCGACGACAGCGTGGAGCGCGGCAAGCCGCACCCCGACATGGCCCTGCATGTCGCC
CGGGGGCTCGGGATCCCTCCGGAGCGGTGCGTGGTGATCGGTGACGGGGTGCCCGACGCC
GAGATGGGGCGGGCCGCCGGTATGACGGTCATCGGTGTCTCGTACGGCGTGTCCGGCCCC
GACGAACTGATGCGGGCGGGAGCGGACACGGTCGTGGACTCCTTCCCCGCGGCGGTCACC
GCCGTACTGGACGGACACCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006402 HAD-superfamily hydrolase, subfamily IA, variant 3 (Family)
 [96-193]  5.59999999999999e-11 TIGR01509
TIGR01509   HAD-SF-IA-v3
IPR006439 HAD-superfamily hydrolase, subfamily IA, variant 1 (Family)
 [79-187]  2.5e-07 TIGR01549
TIGR01549   HAD-SF-IA-v1
IPR023214 HAD-like domain (Domain)
 [10-27]  7.79999999999999e-40 G3DSA:3.40.50.1000 [88-220]  7.79999999999999e-40 G3DSA:3.40.50.1000
G3DSA:3.40.50.1000   HAD-like_dom
 [10-222]  9.40003071030835e-51 SSF56784
SSF56784   HAD-like_dom
SignalP
 [1-45]  0.105 Signal
Eukaryota   
TMHMM No significant hit