close all open/close all

CDS information : Alnu_00200


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction16,797 / 15,877 / - [in whole cluster]
16,797 / 15,877 / - [in contig]
Locationcomplement(15877..16797) [in whole cluster]
complement(15877..16797) [in contig]
TypeCDS
Length921 bp (306 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-glycosynthase
Product (GenBank)AlnA
Gene
Gene (GenBank)alnA
EC number
Keyword
  • dioxan moiety
  • C-ribosylation
Note
  • C-glycosynthase is newly proposed family of enzymes in following publication. Ref. PMID: 22474343
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
[23297194] Structural basis for C-ribosylation in the alnumycin A biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2013)
[24015959] Chemoenzymatic synthesis of novel C-ribosylated naphthoquinones. (ACS Chem Biol. , 2013)
[25081867] Molecular evolution of the bacterial pseudouridine-5'-phosphate glycosidase protein family. (FEBS J. , 2014)
Related Reference
ACC
D6B641
PmId
[25081867] Molecular evolution of the bacterial pseudouridine-5'-phosphate glycosidase protein family. (FEBS J. , 2014)

close this sectionSequence

selected fasta
>C-glycosynthase [AlnA]
MERQPDQLLEVSDEIATALAERRPVVALESSLITTDPSSETASLIEKAVRGAGAVPATIG
IAGGKLVVGLTDSLIERFASTKGIPKISARDIGGALAGGGLGATTVAGTIVIAERAGIQV
FTTAGIGGVHRRGEDTLDISPDLLQFRKTKMTVVSGGAKSILDHRLTAEYLETAGVPVYG
YRTDKLAAFVVREADVPVTRMDDLHTAARAAEAHWQVNGPGTVLLTSPIDEQDAVDEAIV
EAAIAEALAQCDQEGIVGNAVSPYLMKALARASGGMLPKAGRSLLLSTARVAGEFSAALS
AVQAER
selected fasta
>C-glycosynthase [AlnA]
ATGGAACGACAGCCCGACCAGCTGCTAGAGGTCAGCGACGAGATCGCCACCGCGCTCGCG
GAACGGCGTCCGGTGGTGGCGCTGGAGTCCTCGCTCATCACCACCGACCCCTCGTCCGAG
ACCGCCTCACTGATCGAGAAGGCGGTACGGGGCGCCGGGGCCGTACCCGCCACCATCGGG
ATCGCCGGCGGGAAACTCGTCGTCGGTCTGACCGACTCCCTCATCGAACGCTTCGCCTCC
ACCAAGGGCATTCCGAAGATCAGCGCGCGGGACATCGGCGGCGCGCTGGCCGGCGGCGGC
CTCGGGGCGACGACGGTGGCCGGCACCATCGTGATCGCCGAGCGGGCCGGCATCCAGGTC
TTCACCACGGCGGGCATCGGCGGTGTGCACCGCAGGGGCGAGGACACCCTCGACATCTCC
CCCGACCTGCTCCAGTTCCGCAAAACGAAGATGACGGTGGTCTCCGGCGGCGCGAAGAGC
ATCCTGGACCACCGGCTGACCGCCGAGTACCTGGAGACGGCCGGTGTCCCCGTGTACGGG
TACCGCACCGACAAACTCGCGGCCTTCGTGGTGCGCGAAGCCGATGTGCCCGTGACCCGC
ATGGACGATCTGCACACCGCCGCGCGCGCCGCCGAGGCGCACTGGCAGGTCAACGGCCCC
GGCACGGTGCTGCTCACCAGTCCCATCGACGAGCAGGACGCGGTGGACGAGGCGATCGTC
GAGGCCGCCATCGCCGAGGCCCTCGCCCAGTGCGACCAGGAGGGCATCGTGGGCAACGCG
GTCAGCCCGTACCTGATGAAGGCGCTCGCCAGGGCCTCCGGCGGCATGCTGCCCAAGGCC
GGGCGCTCCCTGCTGCTCAGCACCGCCCGCGTCGCGGGAGAGTTCTCCGCCGCCCTGAGC
GCCGTACAGGCCGAGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007342 Pseudouridine-5'-phosphate glycosidase (Family)
 [14-298]  2.59999999999995e-86 PF04227
PF04227   Indigoidine_A
IPR022830 Indigoidine synthase A-like (Domain)
 [5-301]  2.59998233910302e-74 SSF110581
SSF110581   Indigdn_synthA
SignalP
 [1-28]  0.042 Signal
Eukaryota   
TMHMM No significant hit