close all open/close all

CDS information : Alnu_00210


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction16,988 / 18,046 / + [in whole cluster]
16,988 / 18,046 / + [in contig]
Location16988..18046 [in whole cluster]
16988..18046 [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Aln7
Gene
Gene (GenBank)aln7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
B6SEG3
NITE
Alnu_00180
PmId
[22474343] Biosynthetic pathway toward carbohydrate-like moieties of alnumycins contains unusual steps for C-C bond formation and cleavage. (Proc Natl Acad Sci U S A. , 2012)
ACC
Q93IZ2
NITE
Actino_00090
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)

close this sectionSequence

selected fasta
>hypothetical protein [Aln7]
MRHKVAYAVVAAAAVVALLPATAQSAPTASQAGSGGGTVLFQDTYGTGFTTGENGNWLLQ
GDAEWPTGDAVVTTPGGVLNVVPTGVNPKTGDPAYARSTGPDGGADSDDHIKWIAFPNRF
TAENVPGFEVPDTGSISCVHKVAGRTFGTENPFGSTVKDPASDIRLASIALITADFESRA
IADFSVTNDTIYAIYERLPSDTEDYASYGYAIPLAKTAPGAMHELEVRLDQSGKRVTWFV
DGRQKLQTDKIGTRAFDRKYMTLDHGGTEERVELDQITCGMGLGSLLDGAKPGAADGGAL
VRLKHKDGFYFDPRRGEPVAQKFFDPESKVENRLFGQGSEIRADWTKVIRRP
selected fasta
>hypothetical protein [Aln7]
ATGAGACACAAGGTTGCGTACGCCGTGGTGGCCGCGGCGGCCGTGGTGGCGCTGCTGCCG
GCGACCGCGCAGTCCGCGCCGACGGCGTCGCAGGCGGGGTCGGGCGGCGGGACCGTCCTG
TTCCAGGACACGTACGGCACCGGCTTCACCACCGGTGAGAACGGCAACTGGCTGCTCCAG
GGCGATGCGGAGTGGCCGACCGGGGACGCCGTCGTCACCACGCCGGGCGGGGTGCTCAAC
GTGGTGCCCACCGGCGTCAACCCGAAGACGGGCGACCCGGCCTACGCCCGCAGCACCGGA
CCGGACGGCGGCGCGGACTCGGACGACCACATCAAGTGGATCGCCTTCCCCAACCGGTTC
ACCGCCGAGAACGTCCCGGGCTTCGAGGTGCCGGACACCGGCTCCATCAGCTGTGTGCAC
AAGGTGGCGGGCCGGACCTTCGGCACCGAAAACCCGTTCGGGAGCACCGTCAAGGACCCG
GCGTCCGACATCCGGCTCGCCTCGATCGCGCTGATCACCGCCGACTTCGAGTCCCGGGCG
ATCGCCGACTTCTCGGTCACGAACGACACCATCTACGCCATCTACGAGCGCCTGCCGAGC
GACACGGAGGACTACGCCTCGTACGGCTACGCGATCCCGCTGGCCAAGACGGCGCCGGGG
GCGATGCACGAACTGGAGGTCCGGCTGGACCAGAGCGGCAAGCGCGTGACCTGGTTCGTG
GACGGCCGGCAGAAGCTCCAGACCGACAAGATCGGCACGCGCGCCTTCGACCGCAAGTAC
ATGACGCTCGATCACGGCGGCACGGAGGAGCGGGTCGAACTCGACCAGATCACCTGCGGC
ATGGGGCTGGGCAGTCTGCTGGACGGGGCCAAGCCGGGCGCGGCCGACGGCGGGGCGCTG
GTGCGGCTCAAGCACAAGGACGGCTTCTACTTCGATCCGCGGCGCGGTGAGCCGGTGGCA
CAGAAGTTCTTCGACCCCGAGAGCAAGGTCGAGAACCGGCTCTTCGGCCAGGGCTCCGAG
ATCAGGGCGGACTGGACGAAGGTGATCCGCAGGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-25]  1 Signal
Eukaryota   
 [1-25]  1 Signal
Bacteria, Gram-positive   
 [1-25]  1 Signal
Bacteria, Gram-negative   
TMHMM
 [5-27]  Transmembrane (i-o)
Transmembrane 1