close all open/close all

CDS information : Alnu_00230


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction19,916 / 19,359 / - [in whole cluster]
19,916 / 19,359 / - [in contig]
Locationcomplement(19359..19916) [in whole cluster]
complement(19359..19916) [in contig]
TypeCDS
Length558 bp (185 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Aln8
Gene
Gene (GenBank)aln8
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [Aln8]
MLSIPSRRLVRGGLGTLVGVLVLPLIGSAPAGAQQDARGSAKAVSMTELDFLLGDYTCAY
TDLTLEEPTTVTLNWDTKKTLEGKFYEMHLKSPAFEGRWVFGLNTVDNRYTSFYWDTWGN
TGTASSPGWKRGMLRFQGPYITPGGHADSKDEFRVVNSDRFTDDAFIRFEGQPWKQISHV
DCRRS
selected fasta
>hypothetical protein [Aln8]
ATGCTCTCCATACCTTCGCGGCGCCTCGTCCGGGGCGGCCTCGGGACACTCGTCGGCGTG
CTCGTGCTCCCGCTGATCGGCTCGGCGCCCGCCGGGGCCCAGCAGGACGCGAGAGGGTCG
GCGAAGGCGGTCTCCATGACGGAACTCGACTTCCTGCTCGGCGACTACACCTGCGCGTAC
ACCGACCTCACCCTTGAGGAGCCCACCACGGTCACCCTCAACTGGGACACCAAGAAGACC
CTTGAGGGCAAGTTCTACGAGATGCACCTCAAGAGCCCCGCCTTCGAGGGGCGCTGGGTC
TTCGGCCTGAACACGGTCGACAACCGGTACACCTCCTTCTACTGGGACACCTGGGGCAAC
ACCGGAACCGCGTCCTCCCCCGGCTGGAAGCGCGGCATGCTGCGCTTCCAGGGCCCGTAC
ATCACGCCCGGCGGGCACGCGGACAGCAAGGACGAGTTCCGGGTGGTCAACAGCGACCGG
TTCACCGACGACGCCTTCATCCGGTTCGAGGGTCAGCCGTGGAAACAGATCAGCCATGTG
GACTGCCGCCGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-33]  1 Signal
Bacteria, Gram-positive   
 [1-33]  0.999 Signal
Bacteria, Gram-negative   
 [1-33]  0.964 Signal
Eukaryota   
TMHMM No significant hit