close all open/close all

CDS information : Alnu_00240


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction21,759 / 20,218 / - [in whole cluster]
21,759 / 20,218 / - [in contig]
Locationcomplement(20218..21759) [in whole cluster]
complement(20218..21759) [in contig]
TypeCDS
Length1,542 bp (513 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)AlnT1 transporter
Gene
Gene (GenBank)alnT1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
P46105
NITE
Actino_00140
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)
[17644591] Investigation of transcription repression and small-molecule responsiveness by TetR-like transcription factors using a heterologous Escherichia coli-based assay. (J Bacteriol. , 2007)
[17338074] Initiation of actinorhodin export in Streptomyces coelicolor. (Mol Microbiol. , 2007)
ACC
Q2P9Z6
NITE
Stref_00190
PmId
[16751529] Isolation, characterization, and heterologous expression of the biosynthesis gene cluster for the antitumor anthracycline steffimycin. (Appl Environ Microbiol. , 2006)

close this sectionSequence

selected fasta
>putative drug resistance transporter [AlnT1 transporter]
MTVEEQADTAPPAQYSPKRWATLAVTLFAVFMDMVDNTVLNVALPAVQQDLDASSAQLEW
SVAGYTLAFAAAMITGARLGDQLGRRRIYLIGLGAFVVTSALAGAAVNPEMLIASRILQG
GAAALMVPQVLAMLQVDFPKSERPKAMSMYGMSLAVGGIGGPLLGGVLLEADLFGLGWRP
VFYVNVPVGLAALVAAAILTRESRVETRESFDIRGTLIATVGLISLLFPLVQGRELDWPW
WTFALMIACPVILWLFVRYEHRVIARGESPIIDPALLHHRSSLGGLLVAILFFCGMAYQL
VLTVHLQTGEGYSPIRTAVALVTFTVGVGIGSAVAPQLMPLGRRVVLLGCAVMAVGMGVI
TWTVDHWSGSLEWWHLAPGMIVSGIGLAMVAGTLLTIVLAQMPKSASGAASSLINTAIQI
GVATGVAIVGTVYFTLLEDRHTPTDSAVVGLLTVVGLYTLAGLLALVLPPGRVDVSDVDS
DADTDADSDHHHATAAVGTALPPEAGAKARVAP
selected fasta
>putative drug resistance transporter [AlnT1 transporter]
ATGACGGTGGAAGAACAAGCTGATACGGCGCCCCCGGCGCAGTACAGCCCGAAGCGCTGG
GCGACGCTGGCCGTCACCCTGTTCGCGGTGTTCATGGACATGGTGGACAACACCGTCCTC
AACGTGGCCCTGCCCGCCGTCCAGCAGGACCTGGACGCCTCCTCCGCCCAGCTCGAATGG
TCGGTGGCGGGATACACGCTGGCCTTCGCCGCCGCCATGATCACCGGTGCCCGTCTCGGC
GACCAGCTCGGGCGCCGGCGGATCTACCTCATCGGCCTCGGCGCCTTCGTCGTCACCTCG
GCACTGGCGGGCGCGGCGGTCAACCCGGAGATGCTCATCGCCTCCCGCATCCTCCAGGGC
GGCGCCGCCGCGCTGATGGTGCCCCAGGTCCTGGCGATGCTCCAGGTGGACTTCCCGAAG
TCCGAGCGCCCGAAGGCGATGTCCATGTACGGCATGTCGCTGGCCGTGGGCGGCATCGGC
GGCCCGCTGCTGGGCGGCGTCCTGCTGGAGGCCGACCTCTTCGGCCTGGGCTGGCGGCCG
GTCTTCTACGTCAACGTTCCCGTCGGACTGGCCGCGCTGGTCGCCGCCGCCATCCTCACC
CGTGAGTCGCGCGTGGAGACCCGGGAGAGCTTCGACATCCGCGGCACCCTGATCGCGACC
GTCGGCCTGATCAGCCTGCTCTTCCCGCTCGTACAGGGACGCGAACTGGACTGGCCCTGG
TGGACCTTCGCCCTGATGATCGCCTGCCCGGTGATCCTCTGGCTGTTCGTCCGCTACGAG
CACCGGGTGATCGCCCGCGGCGAGTCACCGATCATCGATCCGGCCCTGCTGCACCACCGC
AGCTCGCTCGGCGGCCTGCTCGTCGCCATCCTGTTCTTCTGCGGGATGGCCTACCAACTG
GTCCTCACGGTCCACCTCCAGACGGGCGAGGGGTACTCCCCCATCCGCACCGCGGTCGCA
CTGGTCACGTTCACCGTGGGTGTGGGCATCGGCTCGGCCGTGGCCCCTCAGCTGATGCCG
CTCGGCCGCCGGGTGGTGCTCCTGGGCTGCGCGGTCATGGCCGTGGGCATGGGGGTCATC
ACCTGGACCGTCGACCACTGGTCCGGCTCGCTGGAGTGGTGGCACCTGGCACCCGGCATG
ATCGTCTCCGGTATCGGCCTCGCCATGGTCGCCGGGACGCTGCTCACCATCGTGCTGGCC
CAGATGCCCAAGTCCGCCTCGGGCGCCGCGTCCTCGCTGATCAACACAGCCATCCAGATC
GGCGTGGCCACCGGCGTCGCGATCGTGGGCACCGTCTACTTCACGCTGCTGGAGGACCGG
CACACGCCCACCGACTCGGCGGTCGTCGGCCTGCTGACCGTCGTCGGCCTCTACACCCTG
GCCGGACTGCTCGCCCTCGTACTGCCGCCGGGCCGGGTCGACGTGAGCGATGTCGACTCC
GACGCGGACACCGATGCCGATTCCGACCACCACCACGCGACGGCCGCCGTCGGCACAGCC
CTGCCCCCGGAGGCCGGGGCGAAGGCGCGCGTCGCCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [25-49]  8.09999844976855e-07 PR01036 [116-136]  8.09999844976855e-07 PR01036 [146-170]  8.09999844976855e-07 PR01036 [377-396]  8.09999844976855e-07 PR01036
PR01036   TCRTETB
IPR011701 Major facilitator superfamily (Family)
 [27-425]  2.50000000000001e-47 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-476]  1.69998802370953e-67 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [22-473]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [20-42]  Transmembrane (i-o) [57-79]  Transmembrane (o-i) [88-107]  Transmembrane (i-o) [112-134]  Transmembrane (o-i) [146-168]  Transmembrane (i-o) [178-200]  Transmembrane (o-i) [213-230]  Transmembrane (i-o) [240-257]  Transmembrane (o-i) [282-304]  Transmembrane (i-o) [314-336]  Transmembrane (o-i) [345-364]  Transmembrane (i-o) [379-401]  Transmembrane (o-i) [414-436]  Transmembrane (i-o) [446-468]  Transmembrane (o-i)
Transmembrane 14