close all open/close all

CDS information : Alnu_00260


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction22,454 / 23,746 / + [in whole cluster]
22,454 / 23,746 / + [in contig]
Location22454..23746 [in whole cluster]
22454..23746 [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)AlnR4 two component sensory kinase
Gene
Gene (GenBank)alnR4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
O34757
PmId
[15090506] The membrane fluidity sensor DesK of Bacillus subtilis controls the signal decay of its cognate response regulator. (J Bacteriol. , 2004)
Family/Domain
FD
IPR011712

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [AlnR4 two component sensory kinase]
MNDCGGRSMYAQGESYVVYAENRIHDYDHHYDYDSDGGEPGIGVELGATGLRLALFITCA
VQLGYALMAILNLLKWHHESMSLVGAVLILIAFFGLQLFHCNPYAVHLRARIGPWTLVPQ
AALAYAPFPMFGVLWGGFGGFLSGAVLVVLRGSVLAWVLFVLNAAAVCGLALASFALAPS
VYLTLATVVIGLMVYGLTRLSDIVVEQYRLRHRTALAAVSGERLRVARDLHDLLGYSLSA
ITLKSELTLRKVGVDDDRARKELVETLNIARQALADVRAVARGCRNLSVTAELRSVSGVL
DAADVETTIEGEPGDLDPGTGSVLAIVLREAVTNLLRHSAARHCRIEFGEADGQRWLAIS
NDGVEDGVSRTEAGRRGGGLGNLADRLGTVGGELNVTTEWGWFHLRAVLPARAAVPPPRP
GRQPTHHHAH
selected fasta
>putative two-component system histidine kinase [AlnR4 two component sensory kinase]
GTGAACGACTGCGGGGGTCGGTCCATGTATGCGCAGGGGGAAAGCTACGTGGTCTACGCA
GAGAATCGGATCCACGACTACGACCACCACTACGACTACGACTCCGACGGCGGTGAACCC
GGAATCGGAGTGGAATTAGGTGCGACCGGGCTGCGGCTGGCCCTGTTCATCACCTGCGCG
GTCCAGTTGGGCTACGCGCTGATGGCGATACTGAATCTGCTGAAGTGGCACCACGAATCC
ATGAGCCTCGTGGGCGCCGTGCTGATACTGATCGCATTCTTCGGGTTGCAGCTCTTTCAC
TGCAATCCCTATGCCGTTCATCTCAGGGCCAGGATCGGCCCCTGGACGCTCGTCCCGCAG
GCCGCACTGGCCTATGCGCCGTTTCCCATGTTCGGCGTGCTGTGGGGCGGCTTCGGCGGA
TTCCTCTCGGGGGCCGTGCTGGTCGTGCTCCGGGGGTCGGTGCTCGCCTGGGTCCTCTTC
GTCCTCAACGCCGCCGCCGTGTGCGGACTCGCCCTCGCCTCGTTCGCCCTCGCCCCGTCG
GTCTATCTGACGCTCGCCACCGTGGTCATCGGGCTGATGGTCTACGGGCTGACCCGGCTG
AGCGACATCGTCGTCGAGCAGTACAGGCTGCGTCACCGGACGGCCCTGGCCGCGGTCTCC
GGAGAGCGCCTCCGCGTCGCCCGCGACCTGCACGACCTGCTCGGCTACAGCCTCTCCGCC
ATCACGCTGAAAAGTGAACTGACCCTGCGGAAGGTGGGAGTCGACGACGACCGCGCCCGG
AAGGAACTGGTCGAGACGCTGAACATCGCACGGCAGGCACTGGCCGACGTCCGGGCCGTC
GCCCGCGGCTGCCGCAACCTGTCCGTCACGGCGGAGCTGCGCTCGGTGTCCGGAGTGCTG
GACGCGGCGGACGTGGAGACCACGATCGAGGGCGAGCCCGGTGACCTCGACCCGGGAACC
GGCTCGGTCCTGGCCATAGTGCTGCGGGAGGCCGTCACCAACCTGCTGCGGCACAGCGCG
GCGAGGCACTGCCGCATCGAGTTCGGCGAGGCCGACGGGCAGCGGTGGCTGGCGATCTCC
AACGACGGCGTCGAGGACGGGGTGTCACGCACCGAGGCCGGCCGCCGCGGCGGCGGCCTC
GGCAATCTCGCCGACCGGCTGGGTACCGTCGGCGGCGAGCTGAACGTCACCACCGAGTGG
GGCTGGTTCCATCTGCGCGCCGTGCTGCCGGCCCGGGCCGCCGTACCTCCACCCCGTCCC
GGGCGGCAGCCCACGCACCACCATGCACACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [319-411]  0.00199999965421632 SM00387
SM00387   HATPase_c
 [289-410]  7.20000348184352e-06 SSF55874
SSF55874   ATP_bd_ATPase
 [324-410]  0.00014 PF02518
PF02518   HATPase_c
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [222-285]  2e-14 PF07730
PF07730   HisKA_3
SignalP
 [1-11]  0.052 Signal
Bacteria, Gram-negative   
TMHMM
 [52-74]  Transmembrane (o-i) [81-100]  Transmembrane (i-o) [128-150]  Transmembrane (o-i) [155-177]  Transmembrane (i-o) [181-203]  Transmembrane (o-i)
Transmembrane 5