close all open/close all

CDS information : Alnu_00270


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction24,374 / 23,769 / - [in whole cluster]
24,374 / 23,769 / - [in contig]
Locationcomplement(23769..24374) [in whole cluster]
complement(23769..24374) [in contig]
TypeCDS
Length606 bp (201 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)AlnR5 two component response regulator
Gene
Gene (GenBank)alnR5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
Q54821
NITE
Adria_00100
PmId
[7868594] Regulation of daunorubicin production in Streptomyces peucetius by the dnrR2 locus. (J Bacteriol. , 1995)
[8892835] The DnrN protein of Streptomyces peucetius, a pseudo-response regulator, is a DNA-binding protein involved in the regulation of daunorubicin biosynthesis. (J Bacteriol. , 1996)
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)
ACC
O34723
PmId
[15090506] The membrane fluidity sensor DesK of Bacillus subtilis controls the signal decay of its cognate response regulator. (J Bacteriol. , 2004)

close this sectionSequence

selected fasta
>putative two-component system response regulator [AlnR5 two component response regulator]
MIRLIIAEDVPMLRGALVALMELEQDLSVVAEVGNGNDILPTALEHRPDIAVIDIDLPGT
DGLTAAAKLRSCLPSCRVLIITSLGNPAALRRALAAQVDGYVLKDALPSELAQAIRKVAA
GQRVIDPQLALMAWDGPAQQLTPREVDVLRLAAAGEDVRVIAKELHLSIGTVRNYLTTIV
HKLGARNRVDAVRIARDNGVI
selected fasta
>putative two-component system response regulator [AlnR5 two component response regulator]
GTGATACGGCTGATCATCGCCGAGGATGTACCCATGCTCCGCGGGGCACTGGTGGCGTTG
ATGGAACTGGAACAGGACCTCAGCGTCGTGGCGGAGGTGGGCAATGGCAACGACATTCTT
CCCACCGCGCTGGAACACCGGCCCGACATCGCCGTGATCGATATCGATCTGCCCGGCACC
GACGGGCTCACGGCCGCCGCGAAGCTCCGTTCCTGTCTCCCCTCCTGCCGGGTCCTCATC
ATCACGAGCCTCGGCAATCCGGCGGCGCTCCGCCGCGCGCTCGCCGCCCAGGTGGACGGC
TACGTACTCAAGGACGCACTGCCCAGCGAACTGGCCCAGGCGATACGCAAGGTGGCGGCG
GGTCAGCGGGTCATCGATCCGCAGCTCGCCCTGATGGCCTGGGACGGCCCGGCGCAGCAG
CTGACCCCACGCGAGGTGGATGTACTGCGCCTGGCCGCCGCGGGCGAGGACGTGCGCGTC
ATCGCGAAGGAACTGCACCTGAGCATCGGTACGGTGCGCAACTACCTCACGACGATCGTC
CACAAGCTCGGTGCCCGTAATCGGGTCGACGCGGTCCGGATCGCCAGGGACAACGGTGTC
ATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [141-155]  3.50000235434314e-09 PR00038 [155-171]  3.50000235434314e-09 PR00038 [171-183]  3.50000235434314e-09 PR00038
PR00038   HTHLUXR
 [138-195]  3.0999994589937e-24 SM00421
SM00421   HTH_LUXR
 [139-195]  1.4e-17 PF00196
PF00196   GerE
 [134-199]  PS50043
PS50043   HTH_LUXR_2
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [5-115]  2.1e-18 PF00072
PF00072   Response_reg
 [2-115]  4.80000830876748e-25 SM00448
SM00448   REC
 [3-119]  PS50110
PS50110   RESPONSE_REGULATORY
IPR011006 CheY-like superfamily (Domain)
 [1-132]  2.30000440726534e-26 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [121-201]  4.6e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [119-201]  1.29999924468179e-20 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-31]  0.359 Signal
Eukaryota   
TMHMM No significant hit