close all open/close all

CDS information : Alnu_00280


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction24,879 / 25,877 / + [in whole cluster]
24,879 / 25,877 / + [in contig]
Location24879..25877 [in whole cluster]
24879..25877 [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.2 modification addition of starter unit
Productputative beta-ketoacyl synthase
Product (GenBank)AlnI starter unit ketoacyl synthase
Gene
Gene (GenBank)alnI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[19047004] Ketosynthase III as a gateway to engineering the biosynthesis of antitumoral benastatin derivatives. (J Biotechnol. , 2009)
Related Reference
ACC
O68915
NITE
Fren_00090
PmId
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
ACC
Q9F6D4
NITE
R1128_00080
PmId
[11732905] In vitro reconstitution and analysis of the chain initiating enzymes of the R1128 polyketide synthase. (Biochemistry. , 2001)
[12767243] Ketosynthases in the initiation and elongation modules of aromatic polyketide synthases have orthogonal acyl carrier protein specificity. (Biochemistry. , 2003)
[19292437] Biosynthesis of aromatic polyketides in bacteria. (Acc Chem Res. , 2009)

close this sectionPKS/NRPS Module

KS11..331

close this sectionSequence

selected fasta
>putative beta-ketoacyl synthase [AlnI starter unit ketoacyl synthase]
MTRTVLTAGTRHSVLLGIGGYRPRRVVGNAEICRLIDSTEEWIETRSGIVERRFADHDET
LLMMAATAAEKALAQAGTTPAEVDLVLVASMSNLVQTPPLAVRVAHELGAGVAAGVDLSA
ACAGFCHALAMASDAVRAGSARRVLVVGAERMTDIVEPTDRTISFLFADGAGAVVVGDSD
TPGIGPVVRRAYGAHSEALRMTAPWATAGGPAPERPWMRMDGRRVFRWAMDEVAPALART
VREAGLTPAELGAFVPHQANLRMIELMTERLGLTGATAVSRDVVRSGNTSAASIPLALEA
LLASQEASTGDTALLVGFGAGLNFASQVVVLP
selected fasta
>putative beta-ketoacyl synthase [AlnI starter unit ketoacyl synthase]
ATGACACGGACCGTCCTGACAGCCGGGACCCGCCACAGCGTGCTTCTCGGGATCGGCGGC
TACCGGCCGCGCCGGGTGGTCGGCAACGCCGAGATCTGCCGGCTCATCGATTCCACCGAG
GAGTGGATCGAGACCCGCAGCGGCATTGTCGAACGCCGTTTCGCGGACCACGACGAGACC
CTGCTGATGATGGCCGCCACGGCGGCGGAGAAGGCCCTGGCACAGGCCGGAACCACGCCC
GCCGAAGTCGATCTCGTGCTGGTGGCCAGCATGTCCAACCTGGTGCAGACCCCTCCGCTC
GCCGTGCGCGTGGCACACGAGCTGGGCGCGGGCGTCGCCGCGGGCGTCGATCTGTCCGCC
GCCTGCGCCGGCTTCTGCCATGCGCTGGCCATGGCCTCCGACGCGGTCCGCGCGGGCAGC
GCCCGCCGGGTTCTGGTCGTCGGCGCCGAACGCATGACGGACATCGTCGAACCCACCGAC
CGCACCATCTCCTTCCTCTTCGCGGACGGCGCGGGCGCGGTCGTCGTCGGCGACTCCGAC
ACACCGGGGATCGGCCCGGTCGTCAGGCGCGCCTACGGCGCCCACAGTGAGGCGCTGAGG
ATGACCGCCCCCTGGGCCACGGCCGGCGGGCCCGCCCCCGAACGGCCATGGATGCGCATG
GACGGCCGCCGGGTCTTCCGCTGGGCCATGGACGAGGTGGCCCCCGCCCTGGCCCGGACG
GTCCGCGAGGCCGGGCTGACGCCGGCCGAACTCGGCGCCTTCGTTCCCCACCAGGCCAAT
CTCCGCATGATCGAGCTGATGACCGAGCGGCTCGGACTCACCGGCGCCACCGCCGTCTCC
CGTGACGTGGTGCGCTCCGGGAACACGTCGGCGGCGTCCATACCGCTCGCCCTGGAGGCG
CTGCTCGCCTCCCAGGAGGCGTCCACCGGGGACACCGCGCTCCTCGTCGGCTTCGGAGCC
GGCCTCAACTTCGCCTCCCAGGTGGTGGTTCTGCCGTGA
KS11..331
KS31..993

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH) (Family)
 [13-329]  9.9e-96 TIGR00747
TIGR00747   FabH
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [242-329]  2.3e-26 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [117-185]  7.5e-25 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [10-170]  2.89999999999999e-53 G3DSA:3.40.47.10 [171-329]  2.4e-40 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [10-331]  9.00000407957278e-50 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit