close all open/close all

CDS information : Alnu_00290


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction25,874 / 26,416 / + [in whole cluster]
25,874 / 26,416 / + [in contig]
Location25874..26416 [in whole cluster]
25874..26416 [in contig]
TypeCDS
Length543 bp (180 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
ProductNADH-dependent FMN reductase
Product (GenBank)AlnH flavin reductase
Gene
Gene (GenBank)alnH
EC number1.5.1.42
Keyword
  • two-component system
  • C-8 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
[22467789] Characterization of the two-component monooxygenase system AlnT/AlnH reveals early timing of quinone formation in alnumycin biosynthesis. (J Bacteriol. , 2012)
Related Reference
ACC
Q02058
NITE
Actino_00230
PmId
[7615536] Identification of a flavin:NADH oxidoreductase involved in the biosynthesis of actinorhodin. Purification and characterization of the recombinant enzyme. (J Biol Chem. , 1995)
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)

close this sectionSequence

selected fasta
>NADH-dependent FMN reductase [AlnH flavin reductase]
MNRTDRRAVADVEPSRVREGFRAAMAQLAGGVVVVTTEDADGRPYGFTATSFCSVSMDPA
LVLVCLAETSSSYEAFMDCRGFAVSLLGQEQRALATRFATTGADKFRAEDTVTTPRLLPA
VEGALAVLDCDVYARHPAGDHTILVGAVRHVLPGCGEPLVYHDRAFQQLRHPEHPRLPRP
selected fasta
>NADH-dependent FMN reductase [AlnH flavin reductase]
GTGAACCGCACCGACCGGCGGGCCGTCGCCGACGTCGAACCCTCTCGGGTCCGTGAGGGG
TTCCGGGCCGCCATGGCCCAGCTCGCCGGCGGAGTCGTCGTCGTCACCACCGAGGACGCC
GACGGCCGTCCGTACGGATTCACCGCCACCTCGTTCTGCTCCGTCTCCATGGATCCGGCA
CTGGTCCTGGTCTGCCTCGCCGAGACCTCCAGTTCCTACGAGGCCTTCATGGACTGCCGG
GGTTTCGCGGTCAGTCTGCTGGGCCAGGAGCAGCGGGCCCTCGCCACCCGTTTCGCCACC
ACCGGCGCGGACAAGTTCCGCGCCGAGGACACCGTGACCACCCCCCGCCTCCTCCCGGCC
GTCGAGGGCGCGCTCGCGGTCCTGGACTGTGACGTGTACGCCCGCCACCCCGCGGGCGAT
CACACCATCCTGGTGGGCGCCGTACGCCATGTCCTCCCCGGCTGCGGCGAACCGCTCGTC
TACCACGACCGGGCCTTCCAGCAGCTGCGCCACCCGGAACACCCCCGCCTGCCGCGTCCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [25-169]  8.1e-36 PF01613
PF01613   Flavin_Reduct
 [25-168]  1.40000506907309e-54 SM00903
SM00903   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [13-177]  5.30001985225035e-46 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [18-167]  1.29999999999998e-53 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP No significant hit
TMHMM No significant hit