close all open/close all

CDS information : Alnu_00300


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction27,090 / 26,434 / - [in whole cluster]
27,090 / 26,434 / - [in contig]
Locationcomplement(26434..27090) [in whole cluster]
complement(26434..27090) [in contig]
TypeCDS
Length657 bp (218 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)AlnR6 two component response regulator
Gene
Gene (GenBank)alnR6
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR001789, IPR000792

close this sectionSequence

selected fasta
>putative two-component system response regulator [AlnR6 two component response regulator]
MTTVLIVDDQALQRLGFSMLLEQHPDLTVVGEATHGAEAVRLTAELRPDVVLMDVRMPGM
DGIEATRRIVESGGRSRVLVLTTFDLDEYAYAALRAGASGFLLKDALPDELTAGIRAVAS
GDAVIAPGLTRKLIDAFSAHLPGTTPAQDRQLTALTTREREVLTAIATGWSNTEIANRFS
LAESTVKSHVSHILAKIGARDRVQAVIFAYDMGLVRPA
selected fasta
>putative two-component system response regulator [AlnR6 two component response regulator]
ATGACGACTGTCCTCATCGTCGACGACCAGGCCCTGCAACGCCTCGGCTTCAGCATGCTC
CTGGAGCAGCACCCCGACCTGACCGTGGTCGGCGAGGCCACCCACGGCGCCGAAGCGGTC
CGCCTGACCGCCGAACTGCGCCCCGACGTCGTCCTGATGGACGTCCGCATGCCCGGCATG
GACGGCATCGAGGCCACCCGCCGCATCGTGGAGTCGGGTGGCCGCTCACGAGTCCTGGTC
CTGACCACCTTCGACCTGGACGAATACGCGTACGCGGCCCTGCGCGCCGGAGCCAGCGGC
TTCCTCCTCAAGGACGCCCTCCCCGACGAACTCACAGCAGGCATCCGGGCGGTGGCCTCC
GGCGACGCGGTCATCGCCCCCGGCCTGACCCGCAAACTGATCGACGCCTTCTCCGCCCAC
CTCCCCGGCACCACCCCCGCCCAGGACCGCCAGCTCACCGCCCTCACAACGCGCGAACGC
GAGGTGTTGACGGCCATCGCCACAGGCTGGTCCAACACCGAGATCGCCAACCGCTTCTCC
CTGGCCGAGTCCACGGTCAAGTCCCACGTCAGCCACATCCTCGCGAAGATCGGGGCCCGG
GACCGGGTTCAAGCGGTGATCTTCGCCTACGACATGGGGTTGGTGCGGCCGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [155-169]  2.2999993566538e-12 PR00038 [169-185]  2.2999993566538e-12 PR00038 [185-197]  2.2999993566538e-12 PR00038
PR00038   HTHLUXR
 [148-213]  PS50043
PS50043   HTH_LUXR_2
 [169-196]  PS00622
PS00622   HTH_LUXR_1
 [152-209]  3.39999972437717e-25 SM00421
SM00421   HTH_LUXR
 [154-209]  3.8e-18 PF00196
PF00196   GerE
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [3-119]  PS50110
PS50110   RESPONSE_REGULATORY
 [2-115]  6.00001679190159e-36 SM00448
SM00448   REC
 [4-114]  2.90000000000001e-26 PF00072
PF00072   Response_reg
IPR011006 CheY-like superfamily (Domain)
 [1-132]  2.60000517657733e-34 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [121-216]  4.2e-29 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [133-215]  2.49999811956465e-21 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit