close all open/close all

CDS information : Alnu_00310


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction28,232 / 27,087 / - [in whole cluster]
28,232 / 27,087 / - [in contig]
Locationcomplement(27087..28232) [in whole cluster]
complement(27087..28232) [in contig]
TypeCDS
Length1,146 bp (381 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)AlnR7 two component sensory kinase
Gene
Gene (GenBank)alnR7
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Family/Domain
FD
IPR011712, IPR003594

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [AlnR7 two component sensory kinase]
MRDAANGIGPPVQTLLALIVAFCVPLLWRQQRPVLVFALTSVVSSVALALDADSGAEAAR
IVALLNVGRSVRPAQLAVCLGIAIAQTTVAVVVRGAGQPNEQFLQTPVLAIVQSALIAAV
AAAGLVGRVVNAYIRALHERAVRLEVERDQRARLAAAAERARVAREMHDILGHTLAVIVG
LAGGAAGLTETKPKRGAETLRIIADSGRGALAELRRLLAVIGEERDTEDGSPLAPQPGLA
DLDPLLERVRGAGPAVTLHTRGALTDLAPGLQLAVYRVVQESLTNTLKHAASDTTVRVTL
TTEDTSVHARVEDAGPPSTPHSPAPQGEGRGLVGMRERAALYGGSVTAGPNSQGGWTVDA
HFRTTTTPPPPHTAPTEKRPA
selected fasta
>putative two-component system histidine kinase [AlnR7 two component sensory kinase]
GTGCGGGACGCGGCGAACGGCATCGGTCCCCCGGTGCAGACGCTGCTGGCGCTCATCGTG
GCGTTCTGTGTCCCGCTGCTGTGGCGGCAGCAGCGCCCCGTCCTGGTCTTCGCCCTCACC
TCCGTCGTCTCCTCGGTGGCCCTCGCCCTGGACGCCGACTCGGGCGCGGAGGCCGCGCGG
ATCGTGGCACTGCTCAATGTGGGGCGGAGCGTCAGGCCCGCCCAGCTGGCGGTCTGTCTG
GGGATCGCCATCGCGCAGACGACCGTGGCGGTCGTCGTCCGCGGCGCCGGCCAGCCGAAC
GAGCAGTTCCTGCAGACGCCGGTGCTGGCGATCGTGCAGTCGGCCCTCATCGCGGCGGTC
GCCGCGGCGGGTCTGGTCGGCCGGGTCGTGAACGCGTACATCAGGGCGCTGCACGAACGC
GCCGTCCGTCTGGAGGTGGAGCGCGACCAGCGGGCCCGGCTGGCCGCCGCCGCCGAACGC
GCCCGGGTCGCCCGGGAGATGCACGACATCCTCGGCCACACCCTCGCCGTGATCGTCGGC
CTCGCGGGCGGCGCCGCCGGGCTCACCGAGACGAAACCGAAGCGAGGCGCGGAGACCCTG
CGCATCATCGCCGACAGCGGCCGGGGCGCCCTGGCCGAACTGCGCCGCCTGCTGGCCGTC
ATCGGCGAGGAACGCGACACCGAGGACGGCAGCCCCCTGGCCCCGCAGCCGGGCCTCGCC
GATCTCGACCCCCTCCTCGAACGCGTCCGCGGAGCGGGACCCGCCGTCACCCTGCACACC
CGGGGCGCCCTCACCGATCTCGCCCCCGGCCTCCAACTGGCCGTCTACCGCGTGGTCCAG
GAGTCCCTGACGAACACCCTCAAACACGCGGCGTCCGATACGACGGTCCGCGTCACCCTC
ACGACCGAAGACACGTCCGTACACGCGAGGGTCGAGGACGCGGGACCACCCAGCACCCCG
CACTCCCCCGCCCCGCAGGGCGAGGGCCGCGGCCTGGTGGGCATGCGCGAACGGGCGGCG
CTGTACGGAGGAAGCGTCACCGCGGGCCCGAACTCCCAAGGCGGCTGGACGGTGGACGCC
CACTTCCGGACCACCACCACACCGCCCCCGCCACACACCGCACCCACGGAGAAGCGTCCC
GCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [274-362]  8.40000000000001e-06 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
 [273-362]  1.2e-09 PF02518
PF02518   HATPase_c
 [270-372]  1.10000029896148e-07 SM00387
SM00387   HATPase_c
 [239-362]  7.00000734129903e-13 SSF55874
SSF55874   ATP_bd_ATPase
IPR011712 Signal transduction histidine kinase, subgroup 3, dimerisation and phosphoacceptor domain (Domain)
 [159-221]  1.3e-14 PF07730
PF07730   HisKA_3
SignalP
 [1-38]  0.387 Signal
Bacteria, Gram-positive   
 [1-49]  0.708 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o) [33-50]  Transmembrane (o-i) [71-93]  Transmembrane (i-o) [108-130]  Transmembrane (o-i) [170-189]  Transmembrane (i-o)
Transmembrane 5