close all open/close all
Alnu_00310 Alnu_00310   last last

CDS information : Alnu_00320


close this sectionLocation

Organism
StrainCM020
Entry nameAlnumycin
Contig
Start / Stop / Direction30,892 / 28,667 / - [in whole cluster]
30,892 / 28,667 / - [in contig]
Locationcomplement(28667..30892) [in whole cluster]
complement(28667..30892) [in contig]
TypeCDS
Length2,226 bp (741 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AlnT2 transporter
Gene
Gene (GenBank)alnT2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18940666] Characterization of the alnumycin gene cluster reveals unusual gene products for pyran ring formation and dioxan biosynthesis. (Chem Biol. , 2008)
Related Reference
ACC
P96687
PmId
[15941986] The Bacillus subtilis YdfHI two-component system regulates the transcription of ydfJ, a member of the RND superfamily. (Microbiology. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [AlnT2 transporter]
MATFLYRLGRFSFRRRRLVLMLWIAVLAAVGIGAAGVSSSTSDTFAIPGTQSQKALDLLE
KEFPQASADGATARVVFEAPAGQKLTSAAHKAEVESLVGDLKSASQVANVVDPYTGGTVS
KDGSVAYAQVTYEVAQADVTDAARADLEHVAEQGERAGLAVSMGGTAVNEESHQSAAELI
GIVIAALVMVITFGSLVAAGLPLLTALFGVLAAICGITVATSFIDLSSSTSTLALMLGLA
VAIDYALFIVSRYRGELKEGHDPEEAAGRALGTAGSAVVFAGLTVVIALAGLSVIGIKIL
SDIGLGAAFAVVVAVVIALTLLPAMLGFAGGRISAGKLKTRRMRAIEQGEREPMGVRWAR
FVLRNPVKVLGVSVAGLLLLAIPALSLQLGMPGDSTATPGSTQRIAYDTVTDGFGAGYNG
PLTVVVDARGSDDPKAAAQDAVTLLDDLPDVASVSPVSFNETGDVALIRAVPGSSPTSED
TVGLVSDIRDRGAALHDDTGAELMVTGTTALNIDISGKLNDALIPYLCVVVGLALILLML
VFRSILVPLKAAAGFLLSVLATLGVVVAVFQWGWLADVFGVDQTGPIVSVLPIFMVGVVF
GLAMDYQVFLVTRMREEYVHGAEPKEAVIAGFRHGARVVTAAAVIMISVFAGFLFSDTAL
IKSIGLGLAAAVFFDAFVVRMTIVPAVMALLGRRAWALPGRLDRILPNVDVEGEKLRHLL
EEDTERTEGDGIPEPVHTGKG
selected fasta
>hypothetical protein [AlnT2 transporter]
GTGGCCACCTTCCTCTACCGGCTCGGCCGGTTCTCGTTCAGGCGACGACGGCTCGTCCTG
ATGCTGTGGATCGCGGTCCTGGCCGCCGTCGGCATAGGCGCGGCCGGTGTGTCCTCCAGT
ACGTCGGACACCTTCGCCATCCCCGGCACCCAGTCCCAGAAGGCGCTGGACCTCCTGGAG
AAGGAGTTCCCGCAGGCGTCGGCCGACGGGGCCACGGCACGCGTGGTGTTCGAGGCGCCC
GCCGGGCAGAAGCTGACGTCCGCGGCGCACAAGGCCGAGGTCGAGTCGCTGGTCGGCGAC
CTCAAGTCGGCGTCCCAGGTGGCGAACGTCGTCGACCCCTACACCGGCGGCACCGTCAGC
AAGGACGGCTCCGTCGCCTACGCCCAGGTGACCTACGAGGTCGCCCAGGCCGATGTCACC
GACGCCGCCCGCGCCGACCTGGAGCACGTCGCCGAACAGGGCGAGCGGGCCGGTCTCGCG
GTCAGCATGGGTGGCACGGCCGTCAACGAGGAGTCCCACCAGAGCGCGGCCGAGCTGATC
GGCATCGTGATCGCCGCCCTGGTCATGGTCATCACCTTCGGCTCGCTGGTCGCGGCCGGA
CTGCCGCTGCTGACCGCGCTCTTCGGCGTCCTCGCGGCGATCTGCGGGATCACCGTGGCG
ACCTCGTTCATCGACCTCAGCTCCAGCACCAGCACGCTGGCGCTGATGCTGGGCCTCGCG
GTGGCCATCGACTACGCCCTGTTCATCGTCTCCCGCTACCGCGGCGAACTGAAGGAGGGC
CACGATCCGGAGGAGGCCGCGGGGCGCGCGCTGGGCACCGCGGGATCGGCGGTGGTGTTC
GCCGGGCTGACCGTGGTCATCGCACTGGCCGGACTCAGCGTCATCGGCATCAAGATCCTC
TCCGACATCGGTCTCGGCGCCGCGTTCGCGGTCGTCGTCGCCGTGGTCATCGCGCTCACC
CTGCTGCCCGCGATGCTCGGTTTCGCCGGTGGGCGGATCTCGGCCGGGAAGCTCAAGACC
CGTCGTATGCGGGCGATCGAGCAGGGCGAGCGCGAACCTATGGGCGTGCGCTGGGCGCGG
TTCGTCCTGCGCAACCCGGTGAAGGTGCTCGGCGTCTCGGTGGCCGGTCTGCTCCTGCTC
GCCATCCCGGCCCTGTCGCTGCAACTCGGCATGCCCGGCGACTCGACGGCCACCCCCGGC
AGCACCCAGCGCATCGCCTACGACACCGTCACCGACGGCTTCGGGGCCGGCTACAACGGG
CCGCTGACCGTGGTCGTCGACGCCCGCGGCAGCGACGACCCCAAGGCCGCCGCCCAGGAC
GCGGTCACCCTGCTCGACGATCTGCCCGACGTCGCCTCCGTCAGCCCCGTGTCGTTCAAC
GAGACCGGTGACGTGGCCCTGATCCGTGCCGTCCCCGGGAGCTCCCCCACCAGCGAGGAC
ACGGTCGGCCTCGTGTCCGACATCCGCGACCGGGGCGCCGCGCTGCACGACGACACCGGC
GCCGAGCTGATGGTCACCGGCACCACCGCCCTCAACATCGACATCTCCGGCAAGCTGAAC
GACGCCCTGATCCCGTACCTGTGCGTGGTCGTCGGCCTCGCGCTGATCCTGCTGATGCTG
GTGTTCCGCTCGATCCTCGTCCCGCTCAAGGCCGCCGCGGGCTTCCTGCTCAGCGTCCTC
GCCACGCTCGGCGTCGTCGTCGCCGTCTTCCAGTGGGGCTGGCTCGCGGACGTCTTCGGC
GTCGACCAGACCGGCCCGATCGTGAGCGTGCTGCCGATCTTCATGGTCGGCGTGGTGTTC
GGCCTCGCGATGGACTACCAGGTCTTCCTCGTCACCCGGATGCGGGAGGAGTACGTCCAC
GGGGCCGAGCCGAAGGAAGCGGTGATCGCCGGGTTCCGGCACGGGGCCCGTGTCGTCACG
GCCGCCGCGGTCATCATGATCTCCGTGTTCGCCGGGTTCCTCTTCAGCGACACCGCGCTG
ATCAAGTCGATCGGCCTGGGCCTCGCCGCCGCCGTGTTCTTCGACGCCTTCGTCGTACGG
ATGACCATCGTCCCGGCGGTCATGGCCCTGCTCGGCCGCCGCGCCTGGGCACTGCCCGGC
CGACTGGACCGGATACTGCCCAACGTGGACGTCGAGGGCGAGAAGCTGCGGCACCTGCTG
GAGGAGGACACCGAGAGGACCGAGGGCGACGGAATCCCCGAGCCGGTCCACACCGGCAAG
GGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000731 Sterol-sensing domain (Domain)
 [179-328]  PS50156 [525-690]  PS50156
PS50156   SSD
IPR004869 Membrane transport protein, MMPL type (Domain)
 [46-368]  2.70000000000002e-74 PF03176 [473-701]  2.4e-32 PF03176
PF03176   MMPL
SignalP
 [1-42]  1 Signal
Bacteria, Gram-negative   
 [1-39]  1 Signal
Bacteria, Gram-positive   
 [1-34]  0.847 Signal
Eukaryota   
TMHMM
 [19-41]  Transmembrane (i-o) [175-197]  Transmembrane (o-i) [202-224]  Transmembrane (i-o) [229-251]  Transmembrane (o-i) [275-297]  Transmembrane (i-o) [307-329]  Transmembrane (o-i) [369-391]  Transmembrane (i-o) [524-546]  Transmembrane (o-i) [553-575]  Transmembrane (i-o) [590-612]  Transmembrane (o-i) [633-655]  Transmembrane (i-o) [670-692]  Transmembrane (o-i)
Transmembrane 12   
Alnu_00310 Alnu_00310   last last