close all open/close all
first first   Amph_00020 Amph_00020

CDS information : Amph_00010


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction1,824 / 4 / - [in whole cluster]
1,824 / 4 / - [in contig]
Locationcomplement(4..1824) [in whole cluster]
complement(4..1824) [in contig]
TypeCDS
Length1,821 bp (606 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)AmphG
Gene
Gene (GenBank)amphG
EC number
Keyword
Note
Note (GenBank)
  • possible amphotericin export protein
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
Related Reference
ACC
Q9L4X6
NITE
Nysta_00020
PmId
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [AmphG]
MAPDVPEEHEEERESEQPVRRLAALLRPHRRSVGLALTAGVVGILLNAFGPLLLGRVTDL
IADGVLGHGGPAPGVDFGALGRLLMILLVLYVVASVFMLVQNWLVASVVRLLIHDLRHRA
QEKLARLPLRYFDRKPAGETLSRGTDDVDNLQQTLQQTLTDLISSVFSLVIMLSLMLIIS
PSLAGVMLLSVPVSGLLAAWISKRAQPQYAAQWSASGKLTAHVEEMCAGHALVKAFDRRA
EAEQRFDERNEAVYRAGSGAQFASGAIEPVMMFVANLGYVAVAVVGAWKVVNGSLTLGDV
QAFILYARQFSQPIVEIASVAGRLQSGVASAQRVFTLLDAPEQEPEPDRPLAVERVEGRV
EFQDVSFRYSPDTPLIEGLSLSVEPGSTVAVVGPSGAGKTTVANLLMRFYEIDSGRILLD
GTDTAAMNRDDLRSRFGLVLQDTWLFKGTIAENIAYGSPGATRADIVEAARATYADRFIR
TLSQGYDTVLDDESGGVSAGEKQLITVARAFLARPAVLVLDEATSSVDTRTELLIQRAMN
TLRPGRTSFVIAHRLSTIRDADVIVVMKSGRIVEQGTHDQLIDAQGAYARLHAARADAPA
ADVTVG
selected fasta
>putative ABC transporter ATP-binding/permease protein [AmphG]
ATGGCGCCGGACGTTCCTGAGGAGCACGAAGAGGAGCGGGAGTCGGAGCAGCCGGTCCGC
CGGCTCGCCGCTCTGCTGCGCCCGCACCGCCGGTCGGTGGGCCTCGCCCTCACGGCGGGT
GTCGTCGGCATCCTCCTCAACGCCTTCGGCCCGCTGCTGCTGGGCCGGGTCACCGACCTG
ATCGCCGACGGCGTCCTCGGGCACGGCGGACCGGCCCCGGGCGTCGACTTCGGGGCGCTC
GGCAGACTGCTGATGATCCTGCTGGTGCTGTATGTGGTGGCATCGGTGTTCATGCTGGTC
CAGAACTGGCTGGTGGCCTCGGTGGTCCGCCTGCTCATCCACGACCTGCGGCACCGGGCG
CAGGAGAAGCTGGCGCGGCTGCCGCTGCGCTACTTCGACCGGAAGCCGGCGGGCGAGACG
CTCAGCCGCGGCACGGACGACGTCGACAACCTCCAGCAGACCCTCCAGCAGACCCTGACC
GATCTGATCAGCTCGGTGTTCTCGCTGGTCATCATGTTGTCCCTGATGCTGATCATCTCG
CCCTCGCTGGCCGGGGTGATGCTGCTGAGCGTCCCGGTGTCGGGGCTGCTCGCCGCCTGG
ATCAGCAAGCGGGCCCAGCCGCAGTACGCGGCCCAGTGGTCCGCGAGCGGCAAGCTGACC
GCGCATGTCGAGGAGATGTGCGCCGGGCACGCGCTGGTCAAGGCCTTCGACCGGCGGGCG
GAGGCCGAGCAGCGCTTCGACGAGCGCAACGAGGCGGTGTACCGGGCCGGTTCGGGGGCG
CAGTTCGCGTCCGGCGCGATCGAGCCCGTGATGATGTTCGTCGCCAACCTCGGCTATGTC
GCGGTCGCCGTCGTCGGCGCCTGGAAGGTCGTCAACGGCTCACTGACGCTGGGCGATGTG
CAGGCGTTCATCCTGTACGCACGGCAGTTCAGCCAGCCGATCGTGGAGATCGCCTCGGTC
GCGGGCCGCCTCCAGTCCGGGGTGGCCTCCGCGCAGCGGGTGTTCACGCTGCTGGACGCC
CCGGAGCAGGAACCCGAGCCGGACCGCCCGCTCGCGGTGGAACGCGTCGAGGGCCGGGTG
GAGTTCCAGGACGTGTCGTTCCGCTACTCCCCCGACACCCCGCTCATCGAGGGTCTTTCG
CTGTCCGTGGAACCCGGCAGCACGGTGGCGGTCGTCGGACCGAGCGGCGCCGGCAAGACC
ACGGTCGCCAATCTGCTGATGCGCTTCTACGAGATCGACTCGGGCCGCATCCTGCTGGAC
GGCACCGACACCGCCGCGATGAACCGCGACGACCTGCGGTCCCGCTTCGGCCTCGTCCTC
CAGGACACCTGGCTGTTCAAGGGCACGATCGCCGAGAACATCGCCTACGGGTCCCCGGGC
GCGACCCGCGCCGACATCGTGGAGGCGGCCCGCGCGACCTACGCCGACCGGTTCATCCGC
ACCCTGTCGCAGGGGTACGACACGGTCCTGGACGACGAGTCGGGCGGTGTCAGCGCCGGG
GAGAAGCAGCTGATCACGGTCGCGAGGGCGTTCCTCGCCCGGCCGGCCGTGCTCGTCCTG
GACGAGGCGACCAGCTCCGTGGACACCCGTACCGAGCTGCTGATCCAGCGGGCCATGAAT
ACCCTGCGGCCGGGCCGGACGAGCTTTGTGATCGCGCACCGTCTGTCCACCATCAGGGAC
GCCGATGTCATCGTCGTGATGAAGTCCGGCCGGATCGTCGAGCAGGGCACCCATGACCAG
CTCATCGACGCCCAGGGAGCCTACGCCCGGCTGCACGCCGCCCGCGCCGACGCGCCCGCC
GCCGATGTGACGGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [39-313]  1.70000000000001e-48 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [400-525]  1.1e-14 PF00005
PF00005   ABC_tran
 [360-594]  PS50893
PS50893   ABC_TRANSPORTER_2
IPR003593 AAA+ ATPase domain (Domain)
 [385-571]  1.89999859865865e-17 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [10-341]  1.09999184471405e-80 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [497-511]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [35-326]  PS50929
PS50929   ABC_TM1F
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [33-55]  Transmembrane (i-o) [78-100]  Transmembrane (o-i) [166-188]  Transmembrane (i-o)
Transmembrane 3   
first first   Amph_00020 Amph_00020