close all open/close all

CDS information : Amph_00020


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction3,628 / 1,805 / - [in whole cluster]
3,628 / 1,805 / - [in contig]
Locationcomplement(1805..3628) [in whole cluster]
complement(1805..3628) [in contig]
TypeCDS
Length1,824 bp (607 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)AmphH
Gene
Gene (GenBank)amphH
EC number
Keyword
Note
Note (GenBank)
  • possible amphotericin export protein
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
Related Reference
ACC
Q9L4X5
NITE
Nysta_00030
PmId
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [AmphH]
MAPSVRWPTPFQRAAAGRRQPGCHSVLLRLMRTQLRPYAGSVVALVVLHLVQILGTLLLP
TLGAALIDEGVVRHDSDRIGTIGATMAVVALVQIAAALGAAALGARTSTALGRDLRSAVF
RRVLDFSAREIGRFGTPSLLTRSVNDVQQVQNLAQSGLGIFVAAPLMCLGSVLLALRQDV
TLALILVPMVLVVAVCFGLLLSRMAALYARLQQTLDRIGRLLRERITGVRVVRSFARDAH
EGERFTRTNEELLGLSLGVGRLIAVMLPSVLLLMNLFTLGLLWVGARRIDSGSMQIGALS
AFLSYLSLILMSVVMLAFVFLNVPRARVCAERITEVLQAETDVVPPASPRPMAGPAGQVE
LVGAEFRYPGAENAVLRDLSLTLRPGERVAVLGSTGSGKTTLLHLILRLVDVTAGEVRIG
GTDVRELDPSVMAAAVGYVPQRPYLFAGTVASNMRFGRPDATDEELWEVLRIAQHEGFVT
RLGGLDTEIAQGGTTVSGGQRQRLAIARALLRRPAIYLFDDSFSALDQSTEAALRKALVP
YTEGATVITVAQRVASVRDADRIVLLDQGGIAATGTHDALLRDSPTYREIALSQRTREET
AHGAGRS
selected fasta
>putative ABC transporter ATP-binding/permease protein [AmphH]
ATGGCCCCGTCGGTGCGCTGGCCGACTCCGTTCCAACGGGCGGCTGCGGGCCGCCGTCAA
CCGGGGTGTCATTCCGTGCTGTTGAGACTCATGCGCACACAACTGCGCCCCTATGCCGGG
TCCGTTGTCGCTCTGGTCGTTTTGCATCTGGTGCAGATCCTCGGCACGCTGCTGCTGCCG
ACGCTGGGCGCCGCACTCATCGACGAGGGAGTCGTCCGCCACGACAGCGACCGCATCGGC
ACCATCGGCGCCACGATGGCCGTGGTGGCGCTGGTGCAGATCGCCGCGGCGCTGGGTGCC
GCGGCGCTGGGCGCACGCACCTCCACCGCTCTCGGCCGGGATCTGCGGTCCGCGGTCTTC
CGCCGGGTGCTGGACTTCTCCGCCCGTGAGATCGGCCGGTTCGGCACTCCGTCCCTGCTG
ACCCGTTCGGTGAACGACGTCCAGCAGGTGCAGAACCTCGCCCAGTCCGGCCTCGGCATC
TTCGTGGCGGCTCCCCTGATGTGCCTGGGCAGTGTGCTGCTCGCGCTGCGCCAGGATGTG
ACGCTGGCCCTGATCCTGGTCCCGATGGTGCTGGTGGTGGCCGTCTGCTTCGGTCTGCTG
CTGTCCCGGATGGCCGCGCTGTACGCCCGGCTCCAGCAGACGCTGGACCGTATCGGGCGA
CTGCTGCGGGAGCGCATCACCGGGGTGCGTGTGGTGCGTTCCTTCGCCCGCGACGCCCAT
GAGGGCGAGCGCTTCACCCGCACCAACGAGGAACTCCTCGGCCTGTCCCTGGGGGTGGGC
CGGCTCATCGCGGTGATGCTGCCGTCGGTGCTGCTGCTGATGAACCTCTTCACCCTGGGG
CTGCTGTGGGTGGGGGCCCGCCGGATCGACTCGGGCAGCATGCAGATCGGTGCGCTCAGC
GCCTTCCTCAGCTATCTGTCGCTCATCCTGATGTCCGTGGTGATGCTCGCCTTCGTGTTC
CTGAACGTGCCGCGGGCCCGGGTGTGCGCGGAGCGGATCACGGAGGTCCTCCAGGCGGAG
ACCGATGTCGTCCCGCCCGCCTCGCCGCGGCCCATGGCGGGTCCCGCCGGGCAGGTCGAG
CTGGTGGGCGCCGAGTTCCGCTACCCAGGTGCCGAGAACGCCGTGCTGCGGGATCTGTCG
CTGACGCTGCGGCCCGGTGAGCGGGTCGCGGTCCTCGGCAGCACCGGCTCCGGCAAGACC
ACGCTGCTGCATCTGATCCTGCGGCTGGTCGACGTCACCGCGGGCGAGGTGCGGATCGGC
GGCACCGATGTGCGCGAACTGGACCCGTCGGTGATGGCCGCCGCCGTGGGCTATGTGCCG
CAGCGTCCGTATCTGTTCGCCGGGACCGTCGCGAGCAATATGCGCTTCGGCCGGCCGGAC
GCCACGGACGAGGAGCTGTGGGAGGTGCTGCGGATCGCCCAGCACGAAGGCTTCGTGACC
CGGCTCGGCGGCCTCGACACGGAGATCGCTCAGGGCGGCACCACCGTCTCCGGCGGTCAG
CGCCAGCGGCTGGCGATCGCACGGGCGCTGCTGCGCCGCCCCGCCATCTATCTCTTCGAC
GACTCCTTCTCGGCGCTCGACCAGAGCACGGAGGCGGCGCTACGGAAGGCCCTGGTGCCC
TACACCGAGGGCGCCACCGTGATCACCGTGGCGCAGCGCGTCGCCTCCGTGCGCGACGCC
GACCGGATCGTCCTCCTGGACCAGGGCGGCATCGCCGCCACCGGCACCCATGACGCGCTG
CTGCGCGACAGTCCCACCTACCGCGAGATCGCGCTCTCCCAGCGCACCCGAGAGGAAACC
GCTCATGGCGCCGGACGTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [45-313]  3.90000000000001e-32 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [359-593]  PS50893
PS50893   ABC_TRANSPORTER_2
 [400-522]  2.4e-19 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [385-570]  3.00000067992871e-18 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [31-345]  6.89998448199219e-60 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [496-510]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [43-325]  PS50929
PS50929   ABC_TM1F
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [45-67]  Transmembrane (i-o) [82-104]  Transmembrane (o-i) [157-176]  Transmembrane (i-o) [180-202]  Transmembrane (o-i) [264-286]  Transmembrane (i-o) [301-323]  Transmembrane (o-i)
Transmembrane 6