close all open/close all

CDS information : Amph_00030


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction3,840 / 4,874 / + [in whole cluster]
3,840 / 4,874 / + [in contig]
Location3840..4874 [in whole cluster]
3840..4874 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative GDP-mannose 4,6-dehydratase
putative GDP-D-mannose dehydratase
Product (GenBank)AmphDIII
GeneamphDIII
gmd
Gene (GenBank)amphDIII
EC number4.2.1.47
Keyword
  • mycosamine
Note
Note (GenBank)
  • mycosamine biosynthesis protein
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
[14700629] Biosynthesis of deoxyamphotericins and deoxyamphoteronolides by engineered strains of Streptomyces nodosus. (Chem Biol. , 2003)
Related Reference
ACC
Q9L4X4
NITE
Nysta_00040
PmId
[17905880] Analysis of the mycosamine biosynthesis and attachment genes in the nystatin biosynthetic gene cluster of Streptomyces noursei ATCC 11455. (Appl Environ Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative GDP-mannose 4,6-dehydratase [AmphDIII]
MPKRALITGITGQDGSYLAEHLLSQGYQVWGLIRGQANPRKFRVSRLASELSFVDGDLMD
QGSLVSAVDKVQPDEVYNLGAISFVPMSWQQAELVTEVNGMGVLRVLEAIRMVSGLSMSR
TAGTEGQIRFYQASSSEMFGKVAETPQRETTLFHPRSPYGAAKAYGHFITRNYRESFGMY
AVSGMLFNHESPRRGQEFVTRKISLAVARIKLGLQDKLALGNMDAVRDWGYAGDYVRAMH
LMLQQDAPDDYVIGTGEMHTVRDAVRFAFEHVGLDWKDYVVVDPDLVRPAEVEVLCADSS
KAQAQLGWKPSVDFQELMRMMVDADLASVSRQNELDDLLLAHSW
selected fasta
>putative GDP-mannose 4,6-dehydratase [AmphDIII]
ATGCCCAAGCGCGCACTGATCACCGGAATTACCGGCCAGGACGGGTCCTATCTGGCGGAG
CACCTGCTGTCGCAGGGGTACCAGGTGTGGGGTCTCATCCGTGGCCAGGCCAACCCACGC
AAGTTCCGGGTGAGCCGGCTCGCCTCCGAACTCTCCTTCGTCGACGGTGACCTCATGGAC
CAGGGCAGCCTGGTCTCGGCGGTCGACAAGGTACAGCCGGACGAGGTGTACAACCTCGGC
GCGATCTCGTTCGTGCCGATGTCCTGGCAGCAGGCCGAGCTGGTCACCGAGGTGAACGGC
ATGGGCGTGCTGCGGGTCCTGGAGGCCATCCGCATGGTGAGCGGACTGAGCATGTCCCGC
ACCGCGGGCACCGAGGGCCAGATCCGTTTCTACCAGGCGTCCTCCTCGGAGATGTTCGGC
AAGGTCGCCGAGACGCCGCAGCGGGAGACCACGCTCTTCCACCCGCGCAGCCCCTACGGC
GCGGCCAAGGCGTACGGTCACTTCATCACCCGCAACTACCGTGAGTCCTTCGGCATGTAC
GCGGTCTCCGGGATGCTGTTCAACCATGAATCGCCCCGCCGTGGCCAGGAGTTCGTGACC
CGCAAGATCTCCCTCGCGGTCGCCCGCATCAAGCTGGGGCTCCAGGACAAGCTGGCCCTC
GGCAACATGGACGCGGTCCGCGACTGGGGTTACGCGGGCGACTACGTCCGCGCCATGCAT
CTGATGCTCCAGCAGGACGCCCCCGACGACTATGTGATCGGCACCGGGGAGATGCACACC
GTGCGCGACGCGGTCCGCTTCGCCTTCGAGCACGTGGGCCTCGACTGGAAGGACTACGTC
GTCGTCGACCCCGACCTCGTGCGGCCCGCCGAGGTCGAGGTGCTGTGCGCCGACAGCTCC
AAGGCACAGGCCCAGCTGGGCTGGAAGCCGAGCGTCGATTTCCAGGAACTCATGCGGATG
ATGGTCGACGCCGACCTCGCGTCCGTTTCCCGGCAGAACGAACTCGACGACCTTCTGCTG
GCACACAGCTGGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-254]  1.09999999999999e-62 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-192]  1.09999999999999e-44 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit