close all open/close all

CDS information : Amph_00040


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction5,042 / 33,574 / + [in whole cluster]
5,042 / 33,574 / + [in contig]
Location5042..33574 [in whole cluster]
5042..33574 [in contig]
TypeCDS
Length28,533 bp (9,510 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)AmphI
Gene
Gene (GenBank)amphI
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase multienzyme polypeptide housing extension modules 9, 10, 11, 12, 13, and 14
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)

close this sectionPKS/NRPS Module

9 malonyl-CoA
10 malonyl-CoA
11 methylmalonyl-CoA
12 malonyl-CoA
13 malonyl-CoA
14 malonyl-CoA
KS34..396
AT564..880
DH929..1091
KR1402..1578
ACP1679..1749
KS1772..2146
AT2304..2622
KR2943..3122
ACP3225..3295
KS3316..3689
AT3851..4171
KR4478..4658
ACP4761..4831
KS4854..5229
AT5385..5706
KR6018..6197
ACP6299..6369
KS6392..6761
AT6909..7228
kr7578..7744
ACP7840..7914
KS7937..8300
AT8461..8768
KR9082..9261
ACP9362..9432

close this sectionSequence

selected fasta
>polyketide synthase [AmphI]
MDNEQKLRDYLKLATADLRRARRRVGELESASQEPIAIVGMTCRYPGGVSSPEDLWRMVE
AGENGVTPFPTDRGWDLEALASSPTSRGGFLHDAPEFDADFFGISPREAVAMDPQQRVVL
ESAWEAFERAGINPTSVKGSRTGVFIGAMAQDYRVGPADGAEGFQLTGNTGSVLSGRISY
TFGTVGPAVTVDTACSSSLVAVHLATQALRAGECTLALAGGVTVMSGPGTFIEMGRQGGL
SVDGRCRSFGDTADGTGWAEGVGILVLERLSDAIRNGREILAVVRGTAVNQDGASNGLTA
PNGPSQQAVIEQALVNARLSAGDIDVVEAHGTGTTLGDPVEAQALLATYGQQRDEDKPLL
LGSVKSNISHTQAAAGVAGVIKMVMAMRHGVLPRTLLADEPTRHVDWSQGAVRVLTENTE
WPATGAPRRAAVSSFGISGTNAHTIVEQAPEPEPADPEDDAPSTPAAVTGVLPVLLSGRS
PEVLRAQAAALLTTLGTGTPPAPADLAYSLATTRTAFEHRAVLLASDLPELTGRLTAIAE
GTDPAVLADTVTGTARTETRLAVLFTGQGAQRLGAGRELAARFPVFAAALDAALDAFTPH
LDVPLRKVLWGEDADRLDRTEYAQPALFAVEVALYRLLESFEVKPDHLAGHSVGEIAAAH
VAGVFSLDDAATLVAARGRLMQALPEGGAMVAVQASEDEVAPLLAGHEDLVSLAAVNGPS
AVVLSGDETTVTELAARLAADGRKTSRLRVSHAFHSPLMAPMLDEFRNVVEGLTLHSPLL
PVVSDVTGEPATVAQLTSPDYWVDHVRQAVRFADGIDWLARHDVTAFLELGPDSVLSAMA
QNCLDAAGSDALTVPALREGRPEDHTFTAALAALHTQGTALHWDACFTGTGARRTDLPTY
TFQRRRYWPRAVQGGAADLRSVGLGAAHHPLLSAAVSLADSEGALLTGRISLLSHPWLAD
HTVRGATLLPGTAFLELAVRAGDEVGCDRVDELTLAAPLVLPEQGGVQVQLWIGNPDASG
RRSVTVYGRPDADEDAPWTSHATGVLSASRTTSDFDATVWPPADAETLPVDGLYERLAEG
GFGYGPLFQGLRAAWRRGDEVFAEVVLPESGHTDAESFGLHPALLDSALHAASFVDLDER
AAGGLPFSWEGVSLHASGATTLRVRLAPAAGDAVAIAVADDSGQLVLSADSLILRAVAAR
EIDAAAALVRDALFRLDWVPVTAVAASGTAAALVGEDPFGLRALPQFGDLAVHPDLADLA
AADGAVPDTVLLPLTGTGPDADPVTAAHRAATEALAAVRTWLEQDERFAASRLALVTRGA
TTGHDPAAAAVWGLVRSAQSENPGRFLLVDLDADQDTPALPAAALTSEEPQLAVRGEELR
AARLVRRPASTAEAVPAFGGEGAVLVTGGTGGLGAVLARHLVAEHGVRELVLVSRRGGAA
AGAAELVAELAESGARATVVACDVTDRAAVAELVAAHPVSAVVHSAGVLDDGMVGTLTPE
RLTTVLRPKVDAAWNLHEATRDLDLKAFVLFSSVAGVLGSPGQANYAAGNAFLDALAAHR
RAAGLPGLSLAWGPWEQTGGMTGGISEDDLRRMARAGTPALTVEQGLALLDAALDGDDAA
LAPVRLDLSVLRAQGEVPPLLRSLIRGRSRRAAVAGSATAGGLAQRLARLDAESRDELVL
DLVRGQVALVLGHATGAEIDAGRAFRELGFDSLTAVELRNRLNTVTGLRLPATLVFDYPT
VSHLASYVLDELLGTEVEAEVVQRGTAAVADDPIVIVGMACRYPGGVTSPEDLWRLVTEG
TDAVSGFPVNRGWDVENLYHPDPDHPGTAYTRSGGFLHEAGEFDPGFFGMSPREALATDS
QQRLLLEASWEAIERAGIDPVGLRGSATGVFAGVMYSDYSAMLGSPEFEGFQGSGSSPSL
ASGRVSYTLGLEGPAVTVDTACSSSLVAMHWAMQALRSGEISLALAGGVTVMSTPAVFVD
FARQRGLSPDGRCKAFSDSADGVGWSEGVGMLVLERQSDAIRNGHQILAVVRGSAVNQDG
ASNGLTAPNGPSQQRVIRQALASGGLSAGDVDVVEAHGTGTTLGDPIEAQALLATYGRDR
DPEQPLLLGSVKSNIGHTQAAAGVAGVIKMVMSMRHGVLPRTLHVDAPSSHVDWTEGAVE
LLTEQTAWPETGRPRRAAVSSFGISGTNVHTVLEQAPGTTVPAPAAPERTAGAVPLLLSG
RTRDALRAQAARLLTHLQNHPEPSLADLGHSLATTRSRFERRAAVIAQDREGLLASLGSL
AAGRPDPAVVEGEAAGRARVAVMFSGQGSQRAAMGRELYETQPRFAAAFDEVCAALDPLL
DRPLREVVFAAEGSEEAALLDRTGWTQPALFAVEVALYRLVESWGVRADFVTGHSIGEIA
AAHIAGVFTLQDAARLVAARATLMEALPSGGAMVAVQATEEEVAPLLGEGLSVAAVNGPT
SVVVSGDEDPAVELAAEFSGRGRRTKRLRVSHAFHSPHMDAMLDAFRTVAETLSYAAPRI
PLVSDLTGRRADDAEVRTADYWVRHVREAVRFADCVRTLRDAGATLFLELGPDGLLTAMA
EDTLGDERYDHNTALVPLLRADRPEESAAATAAARLQIHGVDLDWTAYLAGTGARRVDLP
TYAFQHAHYWPQLPSAAPSPAGDPADQKLWAAVERGDAAELAAVLGLDEDSLTPLDSLLP
ALSSWRRGNQEKALLDTLRYRVEWTRLSKPAAPVLDGTWLLVSSDATADDETELLDGLAE
ALGAHGARVRRLVLDADCADRAVLGARLADTENADNTAQVLSVLPLDERPTDGPAGFTQG
LALTIALVQALADTGAHGRLWTATRGAVSTGPADPVTHPAQATAWGMGRGVALEHPRLWG
GLVDLPADFDRGAGQRLAEVLAVKDAPDGEDQVALRATGVHGRRLVRHIVDELPSADQFT
ASGSVLITGGTGGLGAETARWLARSGAAHLVLTSRRGPDAPGAAELRAELEQSGASVSIV
ACDVADRDALAAVLDGLSADQPLTGVVHTAGVGHYGPLDALTPAEFAGLTAAKLAGAAHL
DNLLGDRELDFFILFGSIAGVWGSGDQSAYGAANAYLDALALARRARGLAATSIAWGPWG
GTGMAADDAVSGTLRRQGLGLLDPAPALTEMRRAVVRQDVTVTVADVDWTRYAPLFTSAR
PSALISDLPEVRALAAENTPADTGDASEIVQRVRSLSEPEQLRLLTDLVRTEAATVLGHS
SAGAVPEDRAFREIGFDSLTAVELRKHLGAATGLSLPSTMVFDYPTPLELAQYLRAEMVG
SVLEVAGPVATGGTDDEPIAIIGMSCRYPGGVSSPEQLWDLVLSGTDAITDFPVNRGWNT
AGLYDPDPDHPGTTYSTQGGFLHEADEFDPMFFGISPREALVMDPQQRLLLETTWEAFER
AGLTPDTLRGSLTGTFIGSSYQEYGMGAGDGAEGHLVTGTSPSVLSGRLAYVFGLEGPAV
TVDTACSSSLVALHLACQALRNGESNLAVAGGATVMTTPNAFVAFSRQRALAQDGRCKAF
SESADGMTLAEGVGIVLVERLSDARRNGHPVLAVIRGSAINQDGASNGLSAPNGPSQQRV
IRQALANARVAPGEIDLLEAHGTGTPLGDPIEAQALFATYGRTRTPETALLLGSVKSNIG
HSQSAAGVASIIKMVMALRHGVMPQTLHADEPSSHVDWSPGTVRLLGENTDWPQTGRPRR
AAVSSFGISGTNAHVILEQETEAPAAEDEQLAPAPLPVAAGVVPWLLSARGAAALREQAD
RLLTHLVTADPAARPIDIGLSLATSRALFEHRAVVVPPAGTDPLEALRAVAADGPSGVVA
RGVADVAGRTVFVFPGQGSQWAGMGAQLLDESPVFAERIAECAAALAEFTDWNLIDVLRG
AEGAPTLERVDVVQPASFAVMVSLAAVWRAQGVEPDAVVGHSQGEIAAAVVSGALSLRDG
ARVVTLRAQAIGRSLAGRGGMMSVALPVAEVEARLEAFEGRVSVAAENGPRSSVVAGEPE
ALDELHAQLTAEEIRARRVAVDYASHSPHVEDLHDEILELLAEVAPRTSEIPFFSTVTGD
WLDTTVMDAGYWYRSLRGRVLFADAVRDLIAADHRAFIEVSSHPVLAMSVQDMIDDAGVA
GVASGTLRRDNGGLDRFLLSAAEVFVRGVQVDWAAVFEGTGASRVDLPTYAFQHENLWAM
AAAPEAVTAADPEDAAFWTAVEDGDVSALTAALGTDEDSVAAVLPALSSWRRARKERSTV
DSWRYRPTWKPVTKLPQRTLDGTWLLVSADGVDDTDVAEALETGGAEVRRLVLDESCTDR
AVLRERLTDADGLTGIVSVLAGAERTGAVPGTGLVLGVALTVALVQALGDAGIDTPLWAL
TRGAVSTGRSDKVTAPVQAQVTGIGWTAALECPGRWGGVVDLPETLDARAGQRLAAVLAG
ALGDDDQIALRSSGVFTRRIVRADAAPDGSARDWKPRGTTLVTGGSGTLAPHLARWLAEQ
GAEHLVLVSRRGPEAPGAAELRAELAERGTETTLAACDITDRDAVAALLESLKAEGRTVR
TVVHTAATIELHTLDATTLDDFDRVLAAKVTGAQILDELLDDEELDDFVLYSSTAGMWGS
GAHAAYVAGNAYLAALAEHRRARGLTALSLSWGIWADDLQLGRVDPQMIRRSGLEFMDPQ
LALSGLKRALDDDEQVIAVADVDWETYHPVYTSARPTPLFDEVPEVQRLTAAAEQSAGDP
ARGEFAAALLALPAAEQHRKLLETVRTEAASVLGLSSAEDLTDQRAFRDVGFDSLTAVGL
RNRLASVTGLTLPSTMVFDYPNPAALAGFLHSELADVHSAGAVAVTAGAPVDDDPIAIVG
MSCRYPGGITSAEQLWRVSLEEVDAVSVFPADRGWDAEALYDPDPDASGRTYSVQGGFLR
DVADFDPGFFGISPREALSMDPQQRLLLETAWEVFENAGLDPVAQRGSRTGTFIGASYQD
YGAAVPGSEGSEGHMITGSLPSVLSGRVSYLFGLEGPAVTLDTACSSSLVAIHLACQSLR
NGESTLALAGGASIMSTPMSFIGFSRQRALAEDGRCKAYAEGADGMTLAEGVGLILLERL
SDARRNGHEVLAVIRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGVEANDIDVLEGH
GTGTALGDPIEAQALFATYGKDRDPERPVLLGSVKSNIGHTQMASGVASIIKLVHALREG
VAPKSLHIDQPSTHVDWSSGTIQLLTERTEWPETGRPRRAAVSSFGLSGTNVHTVLEQAP
AADAPAAEDTPAPRDALVPVLVSGRGEAALRAQAGALLDLLAERPGIHPTDLAFSLATSR
AALEHRAAVVADDHEALVRGLTALRDGLPGAGLVQGRTGRGRTAFLFTGQGSQRLGMGRE
LYERHPVFADALDAVLARIDGTTERPLRDVLFAAEGSQDAALLHRTGYAQPALFALEVAL
FRLLESWGVTPDYLAGHSVGEIAAAHVAGVLDLDDACTLVAARGRLMQALPEGGAMVALE
AAEDEVLPHLEGLADQVSVAAVNGPRSVVVAGEEEPVLALAAHFAEQGRRTKRLRVSHAF
HSPLMDPMLDDFAAVARALTYHAPSIPFVSNVTGTLAAPEQVCTADYWVSHVRSAVRFAD
GIGWLSTQGGVQTFLELGPDGVLSGMARESLTDASRTALLPTLRGDRPEEQALVTAVAAA
HAHGFDVDWTAWFQGSGARRVALPTYAFQRERYWPDTTAAGITAPAPGSALDAEFWAAVE
HADVASLTASLGLDDATVTAMVPALTAWRQRRGEQSALDSWRYRVTWKPRGGAPGAAPTG
RWLVLVPAEHRDEATAAWAADVEAALATATVRVEVTGTDRAALAARLTEAADGDTFQGVL
SLLALAPGDAGHPGAPAALTLTATALQALGDARIDAPLWNITRGAVAVGRSEQVTAPEQA
AVWGLFRAAALELPARVGGSVDLPEDLDTQAARRLRGILAAADGEDAVAVRASGVFLRRL
AHSPAADTVGSAFDPAAGTVLITGGTGGIGGHLARRLARDGAAHLLLTSRRGPDAPGAGE
LRAELEESGARVTIAACDAADRDALAALLATVPEDAPLTAVFHTAGVVDDHVVDELTPES
FATVLHAKTVAARHLHDLTAGHDLAAFVLFSSTAGLIGAAGQGNYAAANSQLDALAEQRR
AQGLPALSVAWGPWAGSGMVADAAEIAARVRRGGFEPLDPASGVAALLRAVDNGDTSVAV
ADIDWERFLRAFASARPLPLVADLPETAGANAPAAAAGTGSGLREQLAGLPAEERHAHVL
DLLRTQVAAVLGHSDARTVDDDLAFRDLGFDSLTVLELRNALNALTGLSLPASLVYDHPT
PREMADFLLAELLGSLPESTRHAVATRAVDEDPIAVVGLACRFPGGVSTPEELWQLLAEG
RDGITGFPDDRNWDIAALGAGASDTLHGGFLAQVADFDARFFGISPREALAMDPQQRLLL
ETTWEALERAGIDPAALRGSTTGVFVGTNGQDYPNLLRRSTSDVSGYVATGNTASVMSGR
LSYALGLEGPAVTIDTACSSSLVALHWAGHALSAGECDLVVAGGVSVMSTPDSFVEFSTQ
GGLAPDGHCKPFSDDADGTAWSEGVGILVLERLSDAIRNGHEVRGIIRGTAVNQDGASNG
LTAPNGPSQQRVIRQALADARLAPSEIDAVEAHGTGTTLGDPIEAQALLNTYGPGRDTDQ
PLLLGTVKSNIGHTQAAAGVAGVIKMLLAMQHGTLPRTLHVTSPTSHVDWSSGAVSLLTE
ERDWPETGRPRRAGVSAFGVSGTNAHVIVEQAPIDEPVVEPTEEPAPAAEVTTVPWIVSG
RSREALQDQVDRLTAYAAARPELSPLDVGRSLATDRTLFPHRAVLLAGPDGVREAARSVA
SRTRGRTAFLFSGQGAQRALMGRELYERYPAFADALDTVLAQFDTALDFSLREVLFAEPG
TPEAERLNETGWTQPALFAVEVALHRLVESWGLTPDQVAGHSIGEIAAAHVAGVFSLEDA
CALVAARASLMQELPRGGAMLAVRATEEEVAPHLTERVSVAAVNGPSAVVVAGDEAEVAA
IAAHFEAQDRKTTRLRVSHAFHSPLMDPMLTAFARVAESLTYHEPVIPLVSTVTGVPAGA
ELLTPGYWVRHVRETVRFADGVRALREDGVTTFVEIGPDGQLTAAAQQTLDASGDEAPAT
VVALQRRDRSEETTLLEGLATLHTQGAGPDWTAWFAGTGGHRVELPTYAFQRERYWPEPA
APGATGVQDPVDAAFWAAVEREDLESLTASLGLDGDTVTTMVPALSAWRRRTDARSTARD
WRYHESWTALGTPAHSAGAGRVLALVPAEHAGTDWAETLVAALGADPLVVDGTSGSLARE
LADLVPQQATFAPSRRPARTLAAPAESPSTSSTGTSGRHTESTHRTPLLDGQTSPAGTLD
PAGWTVVVSLLAAGTGTLPAPDAAPAAVLEALEAAGVDAPLWCVTRGAVSVAGEAPAAVG
QAALWGMGRVAALEHPERFGGLADLAPDADAATAALLAAHLAEPGGEDQIAVRATGLFGR
RLVRTAVAPGDSGWRPHGTVLVVGGTRAMGARAARWLAREGAARLVLTTSPADSATDTEE
LRAELGRLGAEVTVAPYDGGDRDAARALLDGLTGLTAVVYADDTPADGPAAALAPVDTLA
EAATGRSLDAFVLFGSVAGVWGVRGHTDEAAEGAYVDALARALRAEGTPALAVSWNAWAE
LTDPSTTRHLRMNGLPVMDADAALTALAGAVADGSAAVTVADVRWDTFAPAHHETRPTAL
FDGLPEARTALAGAARDRAEGATASDGYGRWLLEQPAADRDDILLALVSEKAALVLGHAD
TTLVEPDLPFRDLGFDSLTAVDLRNQLTAATGITLPATLVFDHPNPAALAAHLRTELLGG
ATDTAAPVAAPAATGDDPIVIVGMACRFPGGVNSPEDLWQLVLDEVDAVGDFPADRGWDL
DALAGDGPGRSATDQGGFLYDATDFDPGLFGVSPREAMVMDPQQRILLEASWEALERAGI
DPGTLRGSGTTGVFVGGGSGDYRPPAEYGQWQTAQSASLLSGRLAYTFGIQGPTVSVDTA
CSSSLVALHLAAQALRSGECSIALAGGVTVMATPVGFVEFSAQGALSPDGRCRAFSEDAN
GTGWSEGVGMLVVERLSDARRNGHRVLAVLRGSAINQDGASNGLTAPSGPAQQRVIRQAL
ANARLEAADVDAVEAHGTGTKLGDPIEAQALLATYGQDRERPVLVGSLKANIGHTQAASG
VGGVIKMVLAMQHGLLPRSLYTENPSSHVDWTAGNARLLTELTPWPESERVRRAAVSSFG
ASGTNAHLILEQPEPVRQPVEGARPAEDGSPVPVLLSGRSQNALRAQARKLLAHVAGHPE
ETVTDLARTLATTRAVFEHRAAVTAADRDALIAGLTAVAEGTTAAHIVEHQVERTGKHAV
LFSGQGSQQLGMGRDLYERFPAFAEAFDAVLARLDGHLGASLRDVVWHGDQETLNETGHT
QPALFAFEVALYRLVESWGVTPDFVAGHSVGEIAAAHVAGVLSLDDACRLVAARARLMQD
LPRGGAMVAVEATEQEVAAELTEAVSIAAVNGPTSVVLAGAEDAVLAVAAVLAERGRRTS
RLKVSHAFHSVLMDPMLAEFRKVAESLRYEAPRIAVVSNVTGDVAGADELCDADYWVRHV
RGTVRFADGVTALAGRGVRVLLELGPDAVLSALAEQSAPDTVSIPAQRRNRDEVETLVAA
LGRLHVHAAGPRWDAFFDAAPGSWLDLPTYAFQRGRFWPDTLPTAPQGGATAGEADGTDS
AFWDAVAQEDFGSLESVLDVEGDALSKVLPALLDWRRRTSEETQLDSWRHRIVWKRLTGA
AMAHRKPLTGTWLAVVPEGLGEDPWVTTALDALGTRVVRAEVGADGREAMAATLREAAGE
GTRFGGVVSLLALRETVHGDVPEGVALTGTLLQALGDAGIEAPLWCVTRSAVSANRSDRP
RRPLQAAVWGLGRVAALEYPNRWGGLVDLPERADERAAAGLAAVLAGLDGEDQVAVRGSA
VLARRLVPAPDRGQSGAWDPTGTVLITGGTGAIGAHVARRLAKDGVQHLVLLSRRGAEAP
GATALRDELQTLGAGVTLAACDASDRGQLAAVLDAIPDDRPLTAVLHAAGVLDDGVIDRL
TPERYQKVFRAKVTSALLLDELTRDLDLAAFVLFSSASSAVGNPGQANYAAANAVLDALA
EARRVQNLPATSVSWGAWGGGGMADGHGADDAARRAGVAAMDPDLAVESLLRLVTGKEPT
AVVAEVDLDRFASAFGGARPSALLREFPGYRETVAAAAPASPEGTLADRLAGMAPARRLD
TVVDLVRTRAAQVLGYPDIDAVGAERSFRDLGVDSLGAVELRNQLGAETGLSLPATLVFD
HPTPLALGEFVLARLAPEEAGPAVSDEETEIRAVLASVPLDRLREIGVLEPLLQLAGRGG
GAGDDEDGESVDSMTVADLVRAALNGQSDL
selected fasta
>polyketide synthase [AmphI]
ATGGACAACGAACAGAAGCTCCGGGATTACCTCAAGCTTGCGACGGCCGATCTGCGACGC
GCCCGGCGGCGTGTGGGCGAGCTGGAGTCGGCGTCCCAGGAACCGATCGCCATCGTCGGT
ATGACCTGCCGCTACCCAGGCGGCGTCAGCAGCCCCGAGGACCTGTGGCGGATGGTGGAG
GCCGGCGAGAACGGCGTCACCCCGTTCCCCACCGACCGCGGCTGGGACCTGGAGGCGCTC
GCCTCCTCGCCGACCTCCCGGGGCGGATTCCTCCATGACGCGCCCGAGTTCGACGCGGAC
TTCTTCGGCATCTCGCCGCGCGAGGCGGTCGCCATGGACCCGCAGCAGCGGGTCGTCCTG
GAGTCCGCCTGGGAGGCGTTCGAGCGCGCCGGCATCAACCCCACCTCCGTCAAGGGCAGC
CGTACCGGCGTCTTCATCGGCGCCATGGCCCAGGACTACCGGGTCGGTCCCGCCGACGGC
GCCGAGGGCTTCCAGCTCACCGGCAACACCGGCAGCGTGCTGTCCGGCCGTATCTCGTAC
ACCTTCGGCACGGTCGGTCCCGCGGTCACCGTCGACACCGCCTGTTCCTCCTCCCTGGTC
GCCGTCCACCTCGCCACCCAGGCGCTGCGCGCGGGTGAGTGCACCCTCGCCCTCGCGGGC
GGCGTCACCGTCATGTCGGGCCCCGGCACCTTCATCGAGATGGGCCGCCAGGGCGGACTG
TCCGTCGACGGCCGCTGCCGCTCCTTCGGCGACACCGCCGACGGCACCGGCTGGGCCGAG
GGCGTCGGCATCCTCGTCCTGGAGCGGCTGTCCGACGCGATCCGCAACGGCCGCGAGATC
CTCGCCGTGGTCCGCGGCACCGCCGTCAACCAGGACGGCGCCTCCAACGGGCTCACCGCC
CCCAACGGCCCGTCGCAGCAGGCCGTCATCGAGCAGGCCCTCGTCAACGCCCGGCTCTCC
GCGGGCGATATCGACGTCGTCGAGGCGCACGGCACCGGCACCACCCTCGGCGACCCCGTC
GAGGCGCAGGCGCTGCTCGCCACCTACGGTCAGCAGCGCGACGAGGACAAGCCGCTGCTG
CTCGGCTCGGTGAAGTCCAACATCAGCCACACCCAGGCCGCCGCCGGTGTCGCCGGTGTC
ATCAAGATGGTCATGGCGATGCGGCATGGGGTGCTGCCCCGCACCCTCCTCGCCGACGAG
CCCACCCGCCACGTCGACTGGTCCCAGGGCGCCGTCCGCGTCCTCACCGAGAACACCGAA
TGGCCCGCCACCGGCGCCCCCCGCCGCGCGGCCGTCTCCTCCTTCGGCATCAGCGGCACC
AACGCCCACACCATCGTCGAGCAGGCCCCCGAGCCGGAGCCCGCCGACCCCGAGGACGAC
GCCCCGAGCACCCCGGCCGCCGTCACCGGCGTGCTGCCCGTGCTGCTCTCCGGCCGGAGC
CCCGAGGTGCTGCGCGCCCAGGCCGCCGCCCTGCTCACCACCCTCGGCACCGGCACCCCG
CCCGCGCCGGCGGACCTCGCCTACTCGCTCGCCACCACCCGCACCGCTTTCGAGCACCGG
GCCGTGCTGCTCGCCTCGGACCTGCCCGAGCTGACCGGGCGGCTCACCGCGATCGCCGAG
GGCACCGATCCGGCCGTCCTGGCCGACACCGTCACCGGCACCGCGAGAACCGAGACCCGC
CTCGCCGTCCTGTTCACCGGGCAGGGCGCCCAGCGTCTCGGCGCCGGCCGTGAACTGGCC
GCCCGCTTCCCGGTGTTCGCCGCCGCCCTGGACGCCGCCCTCGACGCCTTCACCCCCCAC
CTGGACGTGCCGCTGCGCAAGGTGCTGTGGGGCGAGGACGCCGACCGCCTGGACCGCACC
GAGTACGCACAGCCCGCGCTGTTCGCCGTCGAGGTCGCCCTCTACCGTCTGCTGGAGTCC
TTCGAGGTCAAGCCGGACCACCTGGCCGGCCACTCGGTGGGCGAGATCGCCGCCGCGCAT
GTCGCCGGAGTGTTCTCCCTCGACGACGCGGCCACCCTGGTCGCCGCCCGCGGCCGTCTC
ATGCAGGCGCTGCCCGAGGGCGGCGCCATGGTCGCCGTGCAGGCGAGCGAGGACGAGGTC
GCCCCGCTGCTCGCCGGCCACGAGGACCTGGTGTCCCTCGCCGCCGTCAACGGCCCCTCC
GCCGTCGTCCTCTCCGGGGACGAGACCACCGTCACCGAGCTGGCGGCCCGCCTGGCCGCC
GACGGACGCAAGACGAGCAGGCTGCGTGTCTCGCACGCCTTCCACTCGCCGCTGATGGCC
CCGATGCTCGACGAGTTCCGGAACGTCGTCGAGGGCCTCACCCTGCACAGCCCGCTGCTG
CCCGTCGTCTCCGACGTCACCGGAGAGCCGGCCACCGTCGCCCAGCTCACCTCCCCCGAC
TACTGGGTCGACCATGTCCGTCAGGCCGTCCGCTTCGCCGACGGCATCGACTGGCTCGCC
CGGCACGATGTCACCGCCTTCCTCGAACTCGGCCCCGACAGCGTGCTGTCCGCCATGGCG
CAGAACTGCCTGGACGCCGCAGGATCCGACGCCCTCACCGTGCCCGCACTGCGCGAGGGC
CGCCCCGAGGACCACACCTTCACCGCCGCGCTCGCCGCGCTGCACACCCAGGGCACCGCG
CTGCACTGGGACGCCTGCTTCACCGGCACCGGAGCCCGCCGCACCGACCTGCCGACGTAC
ACCTTCCAGCGCCGCCGCTACTGGCCGCGCGCCGTCCAGGGCGGCGCCGCCGACCTGCGC
TCCGTCGGACTCGGCGCCGCCCACCACCCGCTGCTGTCCGCCGCGGTCTCCCTCGCCGAC
TCCGAGGGCGCCCTGCTGACCGGCCGGATCTCCCTGCTCAGCCACCCGTGGCTCGCCGAC
CACACCGTCCGCGGCGCCACCCTGCTGCCCGGCACCGCCTTCCTGGAGCTGGCCGTCCGC
GCCGGCGACGAGGTCGGCTGCGACCGCGTCGACGAACTGACCCTGGCCGCACCGCTCGTC
CTGCCCGAGCAGGGCGGCGTCCAGGTGCAGCTGTGGATCGGCAACCCGGACGCGTCCGGC
CGCCGCAGCGTCACCGTCTACGGCCGGCCCGACGCCGACGAGGACGCCCCCTGGACGTCC
CACGCCACCGGTGTGCTCTCCGCCTCCCGCACCACCAGCGACTTCGACGCCACCGTCTGG
CCCCCGGCCGACGCCGAGACCCTCCCCGTGGACGGCCTCTACGAGCGGCTCGCCGAGGGC
GGCTTCGGCTACGGCCCGCTCTTCCAGGGCCTGCGGGCCGCCTGGCGCCGCGGCGACGAG
GTGTTCGCCGAGGTCGTGCTGCCCGAGTCCGGCCACACCGACGCCGAGTCCTTCGGACTG
CACCCCGCGCTCCTCGACTCCGCCCTGCACGCGGCGTCGTTCGTCGACCTCGACGAGCGC
GCCGCCGGCGGACTGCCCTTCTCCTGGGAGGGCGTCAGCCTGCACGCGAGCGGTGCCACC
ACCCTGCGGGTGCGGCTGGCCCCGGCCGCCGGTGACGCCGTCGCGATCGCCGTCGCCGAC
GACTCCGGACAGCTCGTCCTGTCCGCCGACTCGCTGATCCTGCGCGCCGTCGCGGCCCGC
GAGATCGACGCCGCCGCCGCGCTGGTCCGCGACGCGCTGTTCCGCCTCGACTGGGTGCCC
GTCACGGCCGTCGCCGCCTCCGGCACCGCCGCGGCACTGGTCGGCGAGGACCCCTTCGGC
CTGCGCGCCCTGCCCCAGTTCGGCGACCTCGCCGTCCACCCGGATCTCGCGGATCTGGCC
GCCGCCGACGGCGCTGTCCCGGACACCGTGCTGCTGCCGCTCACCGGCACCGGACCCGAC
GCCGACCCGGTCACCGCCGCACACCGGGCCGCCACCGAGGCCCTCGCCGCCGTCCGGACC
TGGCTCGAGCAGGACGAGCGGTTCGCCGCCTCCCGGCTCGCCCTGGTCACCCGGGGCGCG
ACCACCGGCCACGACCCGGCCGCCGCCGCGGTCTGGGGCCTGGTGCGCTCCGCCCAGTCC
GAGAACCCCGGCCGCTTCCTCCTCGTCGACCTCGACGCCGACCAGGACACCCCCGCGCTC
CCGGCCGCCGCGCTCACCTCCGAGGAGCCGCAGCTCGCCGTGCGCGGCGAGGAGCTCCGC
GCCGCCCGTCTGGTCCGCCGTCCCGCTTCCACCGCCGAGGCCGTTCCCGCCTTCGGTGGG
GAGGGTGCGGTGTTGGTGACGGGTGGTACCGGTGGTCTGGGTGCGGTGCTGGCGCGTCAT
CTGGTGGCCGAGCACGGTGTGCGTGAGCTGGTTCTGGTCAGTCGTCGTGGTGGTGCGGCG
GCGGGTGCGGCCGAGCTGGTCGCGGAGCTGGCGGAGTCGGGTGCGCGGGCGACGGTGGTG
GCCTGTGATGTGACGGACCGTGCGGCGGTGGCCGAGCTGGTGGCCGCGCATCCGGTGTCG
GCGGTGGTGCACTCCGCCGGTGTCCTGGACGACGGCATGGTCGGCACGCTGACCCCCGAA
CGCCTCACCACCGTGCTCCGTCCCAAGGTGGACGCGGCCTGGAACCTCCATGAGGCCACC
CGCGACCTGGACCTGAAGGCCTTTGTGCTGTTCTCGTCGGTCGCCGGCGTCCTGGGCAGC
CCCGGTCAGGCCAACTACGCCGCAGGCAACGCCTTCCTGGACGCCCTCGCGGCCCACCGC
CGGGCCGCGGGCCTGCCGGGTCTGTCGCTGGCCTGGGGCCCCTGGGAGCAGACCGGCGGC
ATGACCGGCGGCATCTCCGAGGACGACCTGCGCCGCATGGCCCGCGCCGGAACTCCGGCC
CTCACCGTCGAGCAGGGCCTCGCCCTCCTCGACGCCGCCCTCGACGGCGACGACGCCGCG
CTCGCCCCCGTCCGCCTGGACCTCTCCGTCCTGCGGGCCCAGGGCGAAGTGCCGCCGCTG
CTGCGCTCCCTGATCCGCGGCCGCTCCCGCCGTGCCGCCGTCGCCGGGTCCGCCACCGCC
GGCGGGCTCGCCCAGCGTCTGGCCCGCCTGGACGCCGAGAGCCGCGACGAACTGGTCCTG
GACCTCGTCCGCGGCCAGGTCGCCCTCGTCCTCGGTCACGCCACCGGCGCCGAGATCGAC
GCCGGCCGCGCCTTCCGTGAGCTGGGCTTCGACTCCCTCACCGCCGTCGAGCTGCGCAAC
CGCCTGAACACGGTCACCGGACTGCGCCTGCCCGCCACCCTGGTCTTCGACTACCCGACG
GTCAGCCACCTCGCCTCCTATGTCCTGGACGAGCTTCTCGGCACCGAGGTCGAGGCGGAG
GTCGTGCAGCGCGGCACGGCGGCCGTGGCGGACGATCCGATCGTGATCGTGGGCATGGCC
TGCCGCTATCCGGGCGGGGTCACCTCGCCGGAGGACCTGTGGCGCCTGGTCACCGAGGGC
ACGGACGCCGTCTCCGGCTTCCCCGTCAACCGTGGCTGGGACGTGGAGAACCTCTACCAC
CCGGACCCCGACCACCCCGGCACCGCCTACACGCGTTCCGGTGGTTTCCTGCACGAGGCG
GGGGAGTTCGACCCCGGCTTCTTCGGTATGAGCCCCCGTGAGGCGCTGGCGACGGACTCG
CAGCAGCGTCTGCTCCTCGAGGCGTCCTGGGAGGCGATCGAGCGGGCCGGGATCGATCCG
GTCGGTCTGCGGGGCAGTGCGACCGGTGTGTTCGCCGGTGTGATGTACAGCGACTACAGC
GCGATGCTGGGAAGCCCCGAGTTCGAGGGCTTCCAGGGCAGCGGCAGCTCTCCGAGTCTC
GCCTCGGGCCGCGTCTCCTACACGCTGGGCCTGGAGGGTCCGGCGGTCACGGTGGACACC
GCGTGCTCCTCGTCGCTGGTGGCGATGCACTGGGCGATGCAGGCCCTGCGCTCGGGTGAG
ATCTCGCTCGCCCTGGCCGGCGGTGTGACCGTGATGTCCACGCCCGCCGTGTTCGTGGAC
TTCGCGCGGCAGCGGGGTCTGTCGCCCGACGGCCGCTGCAAGGCGTTCTCGGACTCGGCC
GATGGTGTGGGCTGGTCCGAGGGTGTCGGCATGCTGGTGCTGGAGCGGCAGTCCGACGCG
ATCCGCAACGGCCACCAGATCCTCGCGGTCGTCCGCGGTTCGGCCGTCAACCAGGACGGC
GCCTCCAACGGCCTCACCGCCCCCAACGGCCCGTCCCAGCAGCGCGTCATCCGCCAGGCC
CTCGCCAGTGGTGGGCTCTCGGCGGGCGACGTGGATGTCGTCGAGGCGCACGGTACGGGT
ACCACCCTGGGTGACCCGATCGAGGCGCAGGCGCTCCTGGCGACCTACGGCCGGGACCGT
GACCCGGAGCAGCCGCTGCTGCTGGGTTCGGTGAAGTCCAACATCGGTCACACGCAGGCC
GCGGCCGGTGTCGCGGGTGTGATCAAGATGGTCATGTCGATGCGCCACGGTGTACTGCCC
CGCACCCTGCACGTGGACGCCCCGTCCTCGCACGTCGACTGGACCGAAGGCGCGGTCGAG
CTGCTCACCGAGCAGACCGCCTGGCCCGAGACCGGCCGTCCGCGTCGCGCCGCCGTGTCC
TCCTTCGGCATCAGCGGCACCAATGTCCACACCGTCCTGGAGCAGGCGCCGGGCACCACC
GTGCCCGCCCCGGCCGCCCCCGAGCGCACCGCCGGCGCCGTCCCGCTGCTGCTGTCCGGC
CGCACCCGCGACGCCCTGCGCGCCCAGGCCGCCCGCCTGCTCACCCACCTCCAGAACCAC
CCCGAGCCGTCCCTCGCCGACCTCGGCCACTCCCTGGCCACCACCCGCTCCCGCTTCGAG
CGCCGCGCCGCGGTGATCGCGCAGGACCGCGAAGGACTGCTCGCCTCCCTCGGCTCCCTC
GCCGCCGGCCGCCCCGACCCGGCCGTCGTCGAGGGTGAGGCCGCCGGGCGTGCCCGGGTC
GCCGTGATGTTCTCCGGCCAGGGCAGCCAGCGCGCCGCCATGGGCCGCGAACTGTACGAG
ACCCAGCCCCGGTTCGCCGCCGCGTTCGACGAGGTGTGCGCCGCCCTCGACCCGCTGCTC
GACCGGCCGCTGCGCGAGGTCGTGTTCGCCGCCGAGGGCAGCGAAGAGGCCGCGCTGCTC
GACCGCACCGGCTGGACCCAGCCCGCGCTGTTCGCCGTCGAGGTCGCCCTCTACCGACTT
GTCGAGAGCTGGGGCGTCCGCGCCGACTTCGTCACCGGTCACTCCATCGGTGAGATCGCC
GCCGCGCACATCGCCGGGGTGTTCACCCTCCAGGACGCCGCCCGACTGGTCGCCGCCCGC
GCCACCCTCATGGAGGCGCTGCCGTCCGGCGGCGCCATGGTCGCCGTGCAGGCCACCGAG
GAAGAGGTCGCCCCGCTGCTCGGCGAGGGCCTGTCCGTCGCCGCCGTCAACGGCCCCACC
TCCGTGGTCGTCTCCGGCGACGAGGACCCCGCCGTGGAGCTCGCCGCCGAGTTCTCCGGC
CGAGGGCGCCGCACCAAGCGTCTACGGGTGAGCCATGCCTTCCACTCGCCGCACATGGAC
GCCATGCTCGACGCGTTCCGCACGGTCGCCGAGACGCTGTCCTACGCCGCCCCCCGCATC
CCGCTGGTCTCCGACCTGACGGGCCGCAGGGCCGACGACGCCGAGGTGCGCACCGCCGAC
TACTGGGTGCGCCACGTCCGTGAGGCCGTACGGTTCGCCGACTGCGTCCGCACCCTGCGC
GACGCCGGCGCCACCCTCTTCCTCGAACTCGGCCCCGACGGACTGCTGACCGCCATGGCC
GAGGACACCCTCGGCGACGAGCGTTACGACCACAACACGGCACTCGTCCCGCTGCTGCGC
GCCGACCGCCCCGAGGAGAGCGCCGCCGCCACCGCCGCGGCCCGCCTCCAGATCCACGGC
GTCGACCTCGACTGGACCGCGTACCTGGCCGGCACCGGCGCCCGCCGCGTCGACCTGCCG
ACCTACGCCTTCCAGCACGCCCACTACTGGCCGCAGCTGCCCTCCGCCGCGCCCTCCCCG
GCCGGCGACCCGGCCGACCAGAAGCTGTGGGCCGCCGTCGAGCGCGGCGACGCCGCCGAA
CTCGCCGCCGTCCTCGGCCTCGACGAGGACAGCCTCACCCCGCTGGACTCCCTGCTGCCC
GCGCTGAGCTCCTGGCGCCGCGGCAACCAGGAGAAGGCGCTCCTCGACACGCTGCGCTAC
CGCGTCGAGTGGACCCGGCTGAGCAAGCCCGCCGCCCCCGTCCTCGACGGCACCTGGCTG
CTGGTCTCCTCCGACGCCACCGCCGACGACGAGACCGAGCTGCTCGACGGCCTGGCCGAG
GCGCTCGGCGCGCACGGCGCCCGGGTCCGCCGCCTCGTCCTGGACGCCGACTGCGCCGAC
CGGGCCGTGCTCGGCGCCCGCCTCGCCGACACCGAGAACGCCGACAACACCGCCCAGGTG
CTGTCCGTGCTGCCGCTCGACGAGCGCCCCACCGACGGCCCCGCCGGCTTCACCCAGGGC
CTCGCCCTGACCATCGCCCTCGTCCAGGCCCTCGCCGACACCGGCGCCCACGGCCGGCTG
TGGACCGCCACCCGCGGCGCCGTCTCCACCGGACCCGCCGACCCGGTCACCCACCCCGCC
CAGGCCACCGCCTGGGGCATGGGCCGCGGTGTCGCCCTGGAGCACCCCCGCCTGTGGGGC
GGCCTCGTCGACCTCCCGGCCGACTTCGACCGCGGCGCCGGACAGCGCCTCGCCGAGGTC
CTCGCGGTCAAGGACGCCCCCGACGGCGAGGACCAGGTCGCCCTGCGCGCCACCGGTGTG
CACGGCCGCCGCCTGGTCCGCCACATCGTCGACGAGCTGCCCTCCGCCGACCAGTTCACC
GCCTCCGGAAGCGTCCTGATCACCGGCGGCACCGGCGGCCTCGGCGCCGAGACCGCCCGC
TGGCTGGCCCGCTCCGGCGCCGCCCACCTCGTCCTCACCAGCCGCCGCGGCCCCGACGCC
CCCGGCGCCGCCGAACTCCGCGCCGAACTGGAGCAGTCGGGCGCAAGCGTCTCGATCGTG
GCCTGCGACGTCGCCGACCGTGACGCCCTCGCCGCCGTCCTCGACGGACTGTCCGCCGAC
CAGCCCCTCACCGGTGTGGTGCACACCGCGGGCGTCGGCCACTACGGCCCGCTGGACGCG
CTGACGCCCGCCGAGTTCGCCGGCCTCACCGCCGCCAAGCTGGCCGGCGCCGCCCACCTC
GACAACCTCCTCGGCGACCGCGAACTGGACTTCTTCATCCTGTTCGGCTCCATCGCCGGC
GTCTGGGGCAGCGGCGACCAGAGCGCCTACGGCGCTGCCAACGCCTACCTCGACGCCCTC
GCCCTGGCCCGCCGCGCCCGCGGCCTCGCCGCGACCTCCATCGCCTGGGGTCCCTGGGGC
GGCACCGGCATGGCCGCCGACGACGCCGTCTCCGGCACCCTGCGACGCCAGGGCCTCGGC
CTGCTCGACCCCGCGCCCGCCCTCACCGAGATGCGCCGCGCCGTGGTCCGCCAGGACGTC
ACCGTCACCGTCGCGGACGTCGACTGGACCCGCTACGCCCCGCTGTTCACCTCCGCCCGG
CCCAGCGCCCTCATCAGCGACCTGCCCGAGGTCCGTGCCCTGGCCGCCGAGAACACCCCC
GCCGACACCGGCGACGCCTCCGAGATCGTCCAGCGGGTCCGCTCGCTGTCGGAGCCGGAG
CAACTGCGCCTGCTCACCGACCTGGTGCGCACCGAGGCCGCGACCGTGCTCGGTCACTCC
TCCGCCGGCGCCGTACCGGAGGACCGTGCCTTCCGCGAGATCGGCTTCGACTCGCTGACC
GCCGTCGAACTGCGCAAGCACCTCGGCGCCGCCACCGGCCTCTCGCTGCCGAGCACCATG
GTGTTCGACTACCCGACCCCGCTGGAGCTGGCCCAGTATCTGCGGGCCGAGATGGTCGGC
TCCGTCCTGGAGGTCGCGGGCCCCGTCGCCACCGGCGGTACCGACGACGAACCCATCGCC
ATCATCGGCATGAGCTGCCGCTACCCCGGCGGAGTCAGCTCCCCGGAGCAGCTGTGGGAC
CTGGTGCTCTCCGGCACCGACGCGATCACCGACTTCCCGGTCAACCGCGGCTGGAACACC
GCCGGGCTCTACGACCCCGACCCCGACCACCCTGGCACCACCTACTCCACGCAGGGCGGC
TTCCTGCACGAGGCCGACGAGTTCGACCCCATGTTCTTCGGCATCTCGCCCCGCGAGGCG
CTGGTCATGGACCCGCAGCAGCGGCTCCTCCTGGAGACCACCTGGGAGGCCTTCGAACGC
GCCGGACTCACCCCCGACACCCTCCGCGGCAGCCTGACCGGCACCTTCATCGGCTCCAGC
TACCAGGAGTACGGGATGGGCGCCGGCGACGGCGCCGAGGGCCACCTGGTCACCGGCACC
AGCCCCAGCGTGCTCTCCGGCCGCCTCGCCTATGTCTTCGGCCTGGAGGGCCCGGCGGTC
ACCGTCGACACCGCCTGCTCGTCCTCGCTGGTCGCCCTGCACCTGGCCTGCCAGGCGCTG
CGCAACGGCGAGAGCAACCTCGCGGTCGCGGGCGGCGCCACCGTCATGACCACCCCCAAC
GCGTTCGTGGCGTTCAGCCGGCAGCGCGCCCTCGCGCAGGACGGCCGGTGCAAGGCGTTC
TCCGAGAGCGCCGACGGCATGACCCTCGCCGAAGGTGTCGGCATCGTCCTCGTCGAGCGG
CTGTCCGACGCCCGCCGCAACGGCCACCCGGTGCTCGCCGTGATCCGCGGCTCCGCCATC
AACCAGGACGGCGCCTCCAACGGCCTCAGCGCCCCCAACGGCCCCTCCCAGCAGCGCGTC
ATCCGCCAGGCCCTGGCCAACGCCCGGGTCGCCCCCGGCGAGATCGACCTCCTGGAGGCC
CACGGCACCGGCACCCCGCTCGGCGACCCCATCGAGGCGCAGGCCCTGTTCGCCACCTAC
GGCCGCACCCGTACCCCCGAGACCGCGCTGCTGCTCGGCTCGGTGAAGTCGAACATCGGG
CACTCCCAGTCCGCCGCCGGTGTCGCGAGCATCATCAAGATGGTCATGGCGCTGCGCCAC
GGTGTGATGCCCCAGACCCTGCACGCCGACGAGCCCTCCAGCCACGTCGACTGGAGCCCG
GGCACCGTACGGCTGCTCGGCGAGAACACCGACTGGCCGCAGACGGGCCGTCCGCGCCGG
GCCGCGGTGTCCTCCTTCGGCATCAGCGGTACCAACGCCCACGTCATCCTGGAGCAGGAG
ACCGAGGCGCCCGCCGCCGAGGACGAGCAGCTCGCCCCGGCGCCCCTGCCGGTCGCCGCC
GGTGTGGTGCCGTGGCTGCTGTCCGCCCGTGGCGCCGCCGCGCTGCGCGAGCAGGCCGAC
CGCCTCCTCACCCATCTCGTGACCGCCGACCCGGCGGCCCGCCCGATCGACATCGGTCTG
TCCCTGGCCACCTCCCGCGCGCTCTTCGAGCACCGCGCCGTGGTCGTGCCGCCCGCCGGC
ACCGACCCGCTGGAGGCGCTGCGCGCCGTCGCCGCAGACGGGCCCTCGGGCGTCGTCGCC
CGCGGTGTCGCGGACGTCGCGGGCCGCACCGTCTTCGTCTTCCCCGGCCAGGGCTCCCAG
TGGGCGGGCATGGGCGCCCAGCTCCTGGACGAGTCCCCGGTGTTCGCCGAGCGGATCGCC
GAATGCGCCGCCGCCCTCGCCGAGTTCACCGACTGGAACCTCATCGACGTCCTGCGGGGC
GCCGAGGGCGCCCCGACGCTGGAGCGCGTCGACGTCGTCCAGCCCGCCTCGTTCGCCGTG
ATGGTCTCCCTGGCCGCCGTGTGGCGGGCCCAGGGTGTCGAACCCGACGCGGTGGTCGGC
CACTCGCAGGGCGAGATCGCCGCCGCGGTGGTCTCCGGCGCCCTGTCGCTGCGCGACGGC
GCCCGGGTCGTGACGCTCCGCGCCCAGGCCATCGGCCGCAGCCTCGCCGGGCGCGGCGGC
ATGATGTCGGTGGCGCTGCCCGTCGCCGAGGTGGAGGCCCGTCTGGAGGCGTTCGAGGGA
CGGGTGTCCGTCGCCGCCGAGAACGGCCCCCGCTCCTCCGTCGTCGCGGGCGAGCCCGAG
GCCCTGGACGAACTGCACGCACAGCTCACCGCCGAGGAGATCCGGGCCCGCCGGGTCGCC
GTGGACTACGCCTCGCACTCCCCCCATGTCGAGGACCTGCACGACGAGATCCTCGAACTG
CTGGCCGAGGTCGCGCCGCGGACGTCCGAGATCCCGTTCTTCTCGACCGTCACCGGCGAC
TGGCTCGACACCACCGTCATGGACGCCGGCTACTGGTACCGCAGCCTGCGCGGCCGGGTG
CTGTTCGCGGACGCAGTCCGTGACCTGATCGCCGCCGACCACCGTGCCTTCATCGAGGTC
AGCTCCCACCCCGTGCTCGCCATGTCCGTCCAGGACATGATCGACGACGCCGGAGTGGCG
GGTGTCGCCTCCGGCACCCTGCGCCGCGACAACGGCGGTCTCGACCGCTTCCTGCTGTCC
GCCGCCGAGGTGTTCGTCCGCGGTGTCCAGGTCGACTGGGCCGCCGTGTTCGAGGGGACC
GGTGCGTCCCGGGTCGACCTGCCCACCTATGCCTTCCAGCACGAGAACCTGTGGGCCATG
GCCGCCGCCCCGGAGGCCGTCACCGCGGCCGACCCCGAGGACGCCGCGTTCTGGACCGCC
GTCGAGGACGGGGACGTCTCCGCCCTGACCGCGGCCCTCGGCACCGACGAGGACTCCGTC
GCCGCCGTGCTGCCCGCGCTGTCCTCCTGGCGCCGGGCCCGCAAGGAGCGCTCCACCGTC
GACTCCTGGCGCTACCGCCCGACCTGGAAGCCCGTCACCAAGCTCCCGCAGCGCACCCTG
GACGGCACCTGGCTGCTGGTGTCCGCCGACGGCGTCGACGACACCGACGTCGCCGAGGCG
CTGGAGACGGGCGGCGCCGAGGTGCGCCGGCTCGTCCTGGACGAGAGCTGCACCGACCGC
GCCGTGCTGCGCGAGCGCCTCACCGACGCCGACGGCCTGACCGGCATCGTCTCCGTCCTC
GCGGGCGCCGAGCGGACCGGTGCCGTCCCCGGCACCGGGCTCGTCCTCGGGGTCGCCCTC
ACCGTCGCCCTCGTCCAGGCGCTCGGCGACGCCGGTATCGACACCCCGCTGTGGGCCCTG
ACCCGCGGCGCCGTCTCCACCGGCCGCTCCGACAAGGTCACCGCGCCCGTCCAGGCCCAG
GTCACCGGCATCGGCTGGACCGCCGCGCTGGAGTGCCCGGGACGCTGGGGCGGTGTCGTC
GACCTGCCCGAGACACTGGACGCCCGCGCGGGCCAGCGGCTCGCGGCCGTCCTCGCCGGC
GCGCTCGGCGACGACGACCAGATCGCCCTGCGCTCCTCCGGCGTCTTCACCCGCCGTATC
GTCCGCGCCGACGCCGCCCCCGACGGCTCCGCCCGCGACTGGAAGCCGCGCGGCACCACC
CTGGTCACCGGCGGCTCCGGCACCCTCGCCCCGCACCTGGCGCGCTGGCTCGCCGAGCAG
GGCGCCGAACACCTGGTCCTGGTCAGCCGGCGCGGCCCCGAGGCGCCCGGCGCCGCCGAA
CTCCGCGCCGAGCTGGCGGAACGCGGCACCGAGACGACCCTCGCCGCCTGCGACATCACC
GACCGTGACGCCGTCGCCGCCCTCCTCGAAAGCCTGAAGGCCGAGGGCCGCACCGTCCGC
ACGGTGGTGCACACCGCGGCCACCATCGAACTGCACACCCTCGACGCCACCACCCTCGAC
GACTTCGACCGCGTCCTCGCCGCCAAGGTCACCGGCGCGCAGATCCTCGACGAACTCCTC
GACGACGAGGAGCTGGACGACTTCGTCCTGTACTCCTCCACCGCCGGCATGTGGGGCAGC
GGCGCGCACGCCGCGTATGTCGCGGGCAACGCCTATCTGGCGGCCCTCGCCGAGCACCGG
CGCGCCCGCGGCCTGACCGCCCTGTCGCTGTCCTGGGGCATCTGGGCCGACGACCTCCAG
CTCGGCCGAGTCGACCCGCAGATGATCCGCCGCAGCGGCCTGGAGTTCATGGACCCGCAG
CTCGCGCTGAGCGGCCTCAAGCGGGCCCTCGACGACGACGAGCAGGTCATCGCGGTCGCC
GACGTCGACTGGGAGACGTACCACCCCGTCTACACCTCGGCCCGGCCCACCCCGCTGTTC
GACGAGGTCCCCGAGGTGCAGCGGCTCACCGCCGCTGCCGAGCAGAGCGCCGGGGACCCC
GCCCGGGGCGAGTTCGCCGCCGCGCTGCTGGCCCTGCCCGCCGCCGAACAGCACCGCAAG
CTGCTGGAGACCGTCCGCACCGAGGCCGCCTCCGTGCTCGGCCTGTCCTCCGCGGAGGAC
CTCACCGACCAGCGCGCCTTCCGCGACGTCGGCTTCGACTCGCTGACCGCCGTCGGGCTG
CGCAACCGGCTCGCGTCCGTCACCGGGCTGACGCTGCCGTCCACGATGGTCTTCGACTAC
CCGAACCCGGCCGCCCTGGCCGGCTTCCTCCACTCCGAACTGGCCGACGTCCACTCCGCG
GGCGCCGTCGCCGTCACCGCCGGCGCGCCCGTCGACGACGACCCGATCGCCATCGTCGGC
ATGAGCTGCCGCTACCCCGGCGGCATCACCTCCGCCGAGCAGCTGTGGCGGGTCTCGCTG
GAGGAGGTCGACGCGGTCTCCGTCTTCCCGGCCGACCGCGGCTGGGACGCCGAGGCCCTC
TACGACCCCGACCCGGACGCCTCCGGCCGCACCTACTCGGTCCAGGGCGGCTTCCTGCGC
GACGTCGCCGACTTCGACCCCGGCTTCTTCGGCATCTCGCCCCGCGAGGCCCTGTCGATG
GACCCGCAGCAGCGCCTGCTCCTCGAGACGGCCTGGGAGGTCTTCGAGAACGCCGGCCTC
GACCCGGTCGCCCAGCGCGGCAGCCGCACCGGCACCTTCATCGGCGCCAGCTACCAGGAC
TACGGCGCCGCCGTGCCCGGCAGCGAGGGCTCCGAGGGCCATATGATCACCGGCTCGCTG
CCCAGCGTGCTGTCCGGCCGAGTCTCCTACCTCTTCGGCCTCGAGGGCCCGGCCGTCACC
CTCGACACCGCCTGCTCGTCCTCGCTGGTCGCGATCCACCTGGCCTGCCAGTCGCTGCGC
AACGGCGAGAGCACCCTCGCCCTCGCCGGCGGTGCCAGCATCATGTCCACCCCCATGTCG
TTCATCGGCTTCAGCCGGCAGCGGGCCCTCGCCGAGGACGGCCGCTGCAAGGCGTACGCC
GAGGGCGCCGACGGCATGACCCTCGCCGAGGGCGTCGGCCTGATCCTGCTGGAGCGGCTC
TCCGACGCCCGCCGCAACGGCCACGAGGTCCTCGCCGTCATCCGCGGCTCCGCCGTCAAC
CAGGACGGCGCCTCCAACGGACTGACCGCCCCCAACGGCCCCTCCCAGCAGCGCGTCATC
CGCCAGGCCCTCGCCAACGCGGGCGTCGAGGCGAACGACATCGACGTCCTGGAGGGCCAC
GGCACCGGCACCGCCCTCGGCGACCCGATCGAGGCGCAGGCCCTGTTCGCCACCTACGGC
AAGGACCGCGACCCCGAGCGGCCCGTGCTGCTCGGCTCGGTGAAGTCCAACATCGGCCAC
ACTCAGATGGCCTCCGGCGTCGCCAGCATCATCAAGCTGGTCCACGCCCTGCGGGAGGGC
GTCGCCCCCAAGTCGCTCCACATCGACCAGCCGTCCACCCATGTCGACTGGTCCTCCGGC
ACCATCCAGCTGCTCACCGAGCGCACCGAGTGGCCCGAGACCGGCCGTCCGCGCCGCGCC
GCCGTGTCGTCCTTCGGACTCAGCGGCACCAATGTCCACACCGTCCTGGAGCAGGCCCCC
GCCGCCGACGCCCCGGCCGCCGAGGACACCCCCGCACCGCGGGACGCCTTGGTGCCCGTC
CTCGTCTCCGGACGCGGCGAGGCGGCCCTGCGCGCCCAGGCCGGAGCCCTGCTCGACCTG
CTGGCCGAGCGCCCCGGCATCCACCCCACCGATCTGGCGTTCTCCCTCGCCACCTCGCGC
GCCGCCCTCGAGCACCGTGCCGCGGTCGTCGCCGACGACCACGAGGCACTGGTGCGCGGT
CTGACCGCACTGCGCGACGGACTGCCCGGCGCCGGACTCGTCCAGGGCCGCACCGGCCGC
GGACGCACCGCCTTCCTGTTCACCGGACAGGGCAGCCAGCGCCTTGGCATGGGCCGCGAA
CTCTACGAACGCCACCCGGTGTTCGCCGACGCCCTGGACGCGGTGCTCGCCCGGATCGAC
GGCACCACCGAACGCCCCCTGCGCGACGTGCTGTTCGCCGCCGAGGGCTCCCAGGACGCC
GCCCTGCTCCACCGCACCGGCTACGCACAGCCCGCGCTGTTCGCCCTCGAAGTGGCGCTG
TTCCGGCTGCTGGAGTCGTGGGGCGTGACCCCCGACTACCTGGCCGGGCACTCCGTCGGC
GAGATCGCCGCCGCGCATGTCGCCGGCGTCCTCGACCTCGACGACGCGTGCACCCTGGTG
GCCGCCCGCGGCCGGCTGATGCAGGCACTGCCCGAGGGCGGCGCGATGGTCGCCCTGGAG
GCCGCCGAGGACGAGGTGCTGCCGCACCTGGAGGGCCTCGCCGACCAGGTCTCCGTGGCC
GCCGTCAACGGGCCCCGGTCCGTCGTCGTCGCCGGCGAGGAGGAGCCCGTGCTCGCCCTC
GCCGCGCACTTCGCCGAACAGGGGCGCCGCACCAAGCGTCTGCGGGTGAGCCATGCCTTC
CACTCGCCGCTCATGGACCCGATGCTGGACGACTTCGCCGCCGTGGCCCGTGCTCTCACG
TACCACGCGCCGTCGATCCCGTTCGTCTCCAATGTGACCGGCACCCTCGCCGCCCCCGAG
CAGGTGTGCACCGCCGACTACTGGGTCTCCCACGTCCGCTCCGCCGTGCGCTTCGCCGAC
GGCATCGGCTGGCTGTCCACCCAGGGCGGCGTCCAGACCTTCCTGGAGCTCGGCCCCGAC
GGTGTGCTCAGCGGCATGGCCCGCGAGAGCCTCACCGACGCCTCCCGCACGGCGCTGCTG
CCCACCCTGCGCGGCGACCGCCCGGAGGAGCAGGCCCTGGTCACCGCCGTCGCCGCGGCC
CACGCCCATGGCTTCGACGTCGACTGGACCGCCTGGTTCCAGGGCAGCGGCGCCCGCCGG
GTGGCCCTGCCCACCTACGCCTTCCAGCGCGAGCGGTACTGGCCCGACACCACCGCGGCC
GGCATCACCGCCCCCGCCCCCGGCTCCGCACTGGACGCCGAGTTCTGGGCCGCGGTGGAA
CACGCCGACGTCGCCTCGCTCACCGCCTCCCTCGGCCTGGACGACGCGACCGTCACCGCG
ATGGTCCCGGCGCTCACCGCCTGGCGGCAGCGCCGCGGCGAACAGTCCGCGCTCGACTCC
TGGCGCTACCGCGTCACCTGGAAGCCGCGCGGCGGCGCCCCCGGCGCCGCACCCACCGGA
CGCTGGCTCGTCCTGGTCCCGGCCGAGCACCGCGACGAGGCCACCGCCGCCTGGGCCGCC
GATGTCGAGGCCGCCCTCGCCACCGCCACCGTCCGCGTGGAGGTCACCGGCACCGACCGC
GCCGCCCTCGCCGCCCGGCTCACCGAGGCCGCCGACGGCGACACCTTCCAGGGTGTGCTG
TCGCTGCTGGCGCTGGCGCCCGGTGACGCCGGACACCCCGGCGCCCCGGCCGCGCTCACC
CTCACCGCCACCGCCCTCCAGGCGCTCGGCGACGCCCGTATCGACGCCCCGCTGTGGAAC
ATCACCCGCGGAGCCGTCGCCGTCGGCCGCTCCGAGCAGGTCACGGCACCCGAACAGGCC
GCCGTATGGGGCCTGTTCCGCGCCGCCGCCCTCGAACTGCCCGCCCGCGTCGGCGGCAGC
GTCGACCTCCCGGAGGACCTCGACACCCAGGCCGCCCGACGGCTGCGCGGGATCCTGGCC
GCCGCCGACGGCGAGGACGCCGTCGCCGTCCGCGCCAGCGGCGTCTTCCTGCGCCGGCTC
GCCCACAGCCCCGCCGCCGACACCGTCGGCTCCGCCTTCGACCCGGCGGCCGGCACCGTC
CTGATCACCGGCGGCACCGGCGGCATCGGCGGACACCTCGCCCGCCGCCTCGCCCGCGAC
GGCGCCGCCCATCTGCTGCTCACCAGCCGCCGCGGCCCCGACGCCCCCGGCGCCGGCGAA
CTCCGCGCCGAACTGGAGGAGTCGGGCGCCCGTGTCACGATCGCCGCCTGCGACGCCGCC
GACCGCGACGCGCTCGCCGCACTCCTCGCCACGGTGCCCGAGGACGCGCCCCTCACCGCC
GTCTTCCACACCGCGGGCGTCGTCGACGACCATGTGGTGGACGAGCTGACCCCGGAGAGC
TTCGCCACCGTCCTGCATGCCAAGACGGTCGCCGCCCGCCATCTGCACGACCTCACCGCC
GGCCACGACCTCGCCGCGTTCGTCCTGTTCTCCTCGACCGCCGGCCTGATCGGCGCCGCC
GGACAGGGCAACTACGCCGCCGCCAACTCCCAGCTCGACGCCCTCGCCGAGCAGCGCCGC
GCCCAGGGCCTGCCCGCCCTGTCCGTGGCCTGGGGACCCTGGGCCGGCTCCGGCATGGTC
GCCGACGCCGCCGAGATCGCCGCCCGGGTGCGCCGCGGCGGATTCGAACCGCTCGACCCC
GCCTCCGGTGTCGCCGCGCTGCTGCGCGCCGTCGACAACGGCGACACCTCCGTCGCCGTC
GCCGACATCGACTGGGAACGCTTCCTGCGCGCCTTCGCGTCGGCCCGCCCGCTGCCGCTC
GTCGCCGACCTCCCGGAGACGGCGGGCGCCAACGCCCCGGCGGCGGCCGCCGGCACCGGC
TCAGGCCTGCGCGAGCAGCTCGCCGGCCTGCCCGCCGAGGAGCGCCACGCACATGTCCTC
GATCTGCTGCGTACCCAGGTGGCGGCCGTCCTCGGCCACTCCGACGCCCGCACCGTCGAC
GACGACCTGGCCTTCCGGGACCTCGGCTTCGACTCGCTCACCGTCCTGGAGCTGCGCAAC
GCGCTCAACGCCCTCACCGGCCTGAGCCTGCCCGCCTCCCTCGTCTACGACCACCCGACG
CCGCGCGAGATGGCGGACTTCCTGCTCGCCGAACTCCTCGGCTCGCTCCCGGAGTCCACC
CGCCACGCGGTCGCCACCCGGGCCGTCGACGAGGACCCGATCGCGGTCGTCGGCCTCGCC
TGCCGCTTCCCCGGCGGCGTGAGCACGCCCGAGGAGCTGTGGCAGCTGCTGGCGGAGGGC
CGCGACGGCATCACCGGCTTCCCCGACGACCGCAACTGGGACATCGCGGCCCTCGGCGCC
GGCGCCTCCGACACCCTGCACGGCGGATTCCTCGCCCAGGTCGCCGACTTCGACGCCCGC
TTCTTCGGCATCTCGCCCCGCGAGGCGCTCGCCATGGACCCGCAGCAGCGACTGCTGCTC
GAGACCACCTGGGAGGCCCTGGAGCGGGCCGGCATCGACCCGGCCGCGCTGCGCGGCTCC
ACCACCGGTGTGTTCGTCGGCACCAACGGCCAGGACTACCCGAACCTGCTGCGCCGCTCG
ACCTCGGACGTCTCCGGCTATGTCGCCACCGGCAACACCGCCAGCGTGATGTCCGGCCGC
CTCTCCTACGCCCTCGGCCTGGAGGGCCCCGCAGTCACCATCGACACCGCCTGCTCCTCC
TCGCTGGTCGCCCTGCACTGGGCGGGCCACGCGCTGAGCGCCGGCGAGTGCGACCTCGTC
GTCGCGGGCGGCGTCTCGGTGATGTCGACCCCCGACTCCTTCGTCGAGTTCAGCACCCAG
GGCGGCCTGGCCCCCGACGGCCACTGCAAGCCGTTCTCCGACGACGCCGACGGCACCGCC
TGGTCCGAGGGCGTCGGCATCCTGGTCCTGGAGCGGCTCTCCGACGCGATCCGCAACGGC
CACGAGGTCCGCGGCATCATCCGCGGCACCGCCGTCAACCAGGACGGCGCCTCCAACGGA
CTGACCGCCCCCAACGGCCCGTCCCAGCAGCGCGTCATCCGCCAGGCCCTCGCGGACGCC
CGTCTCGCGCCGTCCGAGATCGACGCGGTCGAGGCGCACGGCACCGGCACCACCCTCGGC
GACCCGATCGAGGCGCAGGCCCTCCTCAACACCTACGGCCCGGGCCGGGACACCGACCAG
CCGCTGCTGCTCGGCACCGTCAAGTCCAACATCGGCCACACCCAGGCCGCCGCGGGCGTC
GCCGGCGTCATCAAGATGCTGCTGGCGATGCAGCACGGCACCCTGCCGCGCACCCTGCAC
GTCACCAGCCCCACCAGCCATGTCGACTGGAGCAGCGGCGCGGTGTCGCTGCTCACCGAG
GAGCGCGACTGGCCCGAGACCGGACGGCCGAGGCGCGCCGGTGTCTCCGCCTTCGGCGTC
AGCGGCACCAATGCGCATGTCATCGTGGAGCAGGCTCCCATCGACGAGCCCGTGGTCGAG
CCCACCGAGGAGCCCGCCCCCGCCGCCGAGGTCACCACCGTCCCGTGGATCGTCTCCGGC
CGCAGCCGCGAGGCGCTCCAGGACCAGGTCGACCGGCTCACCGCGTACGCCGCCGCCCGC
CCGGAGCTCTCCCCGCTGGACGTCGGCCGCTCCCTGGCCACCGACCGCACCCTCTTCCCG
CACCGCGCCGTGCTGCTGGCCGGCCCCGACGGGGTGCGCGAGGCGGCTCGTTCGGTCGCG
TCCCGCACCCGGGGCCGTACCGCCTTCCTGTTCTCCGGCCAGGGCGCCCAGCGCGCCCTG
ATGGGCCGCGAACTCTACGAGCGGTACCCGGCGTTCGCCGACGCGCTGGACACGGTCCTC
GCGCAGTTCGACACCGCGCTGGACTTCTCGCTGCGGGAGGTCCTGTTCGCCGAGCCGGGC
ACGCCCGAGGCCGAGCGGCTGAACGAGACCGGCTGGACCCAGCCCGCGCTGTTCGCCGTC
GAGGTCGCCCTCCACCGCCTCGTGGAGTCGTGGGGCCTGACCCCCGACCAGGTCGCCGGT
CACTCCATCGGTGAGATCGCCGCCGCGCATGTCGCCGGGGTGTTCTCGCTGGAGGACGCG
TGCGCGCTGGTCGCCGCCCGCGCCTCCCTGATGCAGGAGCTGCCGCGGGGCGGTGCGATG
CTCGCGGTGCGCGCCACCGAGGAGGAGGTCGCCCCGCATCTGACGGAGCGCGTCTCCGTC
GCGGCGGTCAACGGTCCTTCGGCGGTGGTCGTCGCCGGTGACGAGGCCGAAGTCGCCGCG
ATCGCCGCGCACTTCGAGGCGCAGGACCGCAAGACCACCCGGCTGCGGGTGAGCCATGCC
TTCCACTCGCCGCTCATGGACCCGATGCTCACCGCCTTCGCCCGGGTCGCGGAGTCCCTC
ACCTACCACGAGCCCGTCATCCCGCTGGTCTCCACGGTGACCGGCGTACCCGCCGGAGCC
GAACTCCTCACCCCCGGCTACTGGGTGCGGCACGTCCGCGAGACCGTACGGTTCGCCGAC
GGCGTCCGGGCGCTGCGCGAGGACGGTGTCACCACCTTCGTCGAGATCGGTCCGGACGGA
CAGCTCACCGCCGCCGCCCAGCAGACCCTGGACGCGTCCGGCGACGAGGCACCTGCCACC
GTCGTCGCGCTCCAGCGCCGCGACCGCTCCGAGGAGACCACCCTCCTGGAGGGCCTGGCC
ACCCTGCACACCCAGGGCGCCGGACCCGACTGGACCGCCTGGTTCGCCGGCACCGGCGGA
CACCGCGTCGAACTGCCGACGTACGCCTTCCAGCGCGAGCGCTACTGGCCCGAGCCCGCC
GCGCCCGGCGCCACCGGCGTCCAGGACCCCGTCGACGCCGCCTTCTGGGCCGCCGTCGAG
CGGGAGGACCTGGAGAGCCTCACGGCCTCCCTGGGCCTGGACGGCGACACCGTCACCACG
ATGGTGCCCGCGCTGTCCGCCTGGCGCCGCCGCACCGACGCCCGCTCCACCGCCCGCGAC
TGGCGCTACCACGAGAGCTGGACCGCGCTCGGCACCCCGGCGCACTCCGCGGGAGCCGGC
CGCGTCCTGGCCCTGGTGCCCGCCGAACACGCCGGCACGGACTGGGCGGAGACCCTGGTC
GCCGCCCTGGGCGCCGACCCGCTCGTCGTGGACGGGACCTCCGGCTCCCTCGCCCGGGAA
CTCGCGGACCTAGTGCCCCAACAGGCGACGTTCGCCCCGTCGCGACGCCCGGCACGCACT
CTCGCCGCACCGGCCGAAAGCCCGAGTACGTCCAGTACGGGGACTTCCGGCCGGCACACC
GAGAGCACGCACCGGACGCCGCTCCTGGACGGGCAAACGTCACCTGCCGGGACACTGGAC
CCGGCCGGCTGGACCGTCGTGGTCTCGCTGCTCGCCGCGGGCACCGGCACCCTGCCGGCC
CCCGACGCCGCACCGGCCGCCGTCCTGGAGGCCCTCGAGGCCGCCGGCGTCGACGCCCCG
CTGTGGTGCGTCACCCGCGGCGCCGTCTCCGTCGCCGGGGAGGCACCCGCCGCCGTCGGC
CAGGCCGCCCTCTGGGGCATGGGCCGGGTCGCCGCCCTTGAGCACCCCGAGCGCTTCGGC
GGCCTCGCCGACCTCGCGCCCGACGCCGACGCCGCCACCGCTGCCCTGCTCGCCGCCCAC
CTGGCCGAGCCCGGCGGCGAGGACCAGATCGCCGTCCGCGCCACCGGTCTCTTCGGCCGC
CGCCTGGTGCGCACCGCCGTCGCCCCCGGCGACTCCGGATGGCGCCCGCACGGCACCGTC
CTGGTCGTCGGCGGCACCCGCGCCATGGGCGCCCGCGCCGCCCGCTGGCTCGCCCGCGAG
GGCGCCGCCCGCCTGGTGCTGACCACCTCCCCGGCCGACAGTGCCACCGACACCGAGGAG
CTGAGGGCCGAACTCGGCCGGCTCGGCGCCGAGGTCACCGTCGCCCCGTACGACGGCGGC
GACCGGGACGCGGCCCGCGCCCTCCTGGACGGACTGACCGGCCTCACCGCGGTCGTGTAC
GCCGACGACACCCCGGCGGACGGCCCGGCCGCCGCCCTCGCCCCGGTGGACACCCTCGCC
GAGGCCGCCACCGGCCGCTCCCTGGACGCGTTCGTGCTCTTCGGCTCCGTCGCCGGGGTC
TGGGGCGTGCGCGGCCACACCGACGAGGCCGCGGAAGGCGCCTATGTGGACGCCCTCGCC
CGCGCCCTGCGCGCCGAGGGGACGCCCGCGCTGGCCGTCTCCTGGAACGCCTGGGCCGAG
CTGACCGACCCGTCGACCACCCGCCATCTGCGGATGAACGGCCTGCCGGTGATGGACGCC
GACGCCGCCCTGACCGCCCTCGCCGGTGCCGTCGCCGACGGCTCCGCCGCGGTCACCGTC
GCCGACGTCCGCTGGGACACCTTCGCCCCGGCGCACCACGAGACCCGGCCGACCGCACTC
TTCGACGGCCTGCCCGAGGCCAGGACCGCCCTCGCCGGCGCGGCCCGCGACCGTGCCGAG
GGGGCCACCGCCTCCGACGGCTACGGCCGGTGGCTCCTGGAGCAGCCCGCCGCCGACCGG
GACGACATCCTGCTCGCCCTGGTCAGCGAGAAGGCCGCCTTGGTCCTCGGCCACGCGGAC
ACCACGCTCGTCGAACCCGACCTGCCCTTCCGGGACCTCGGCTTCGACTCGCTGACCGCC
GTGGACCTGCGCAACCAGCTGACCGCCGCCACCGGCATCACACTGCCCGCGACCCTGGTC
TTCGACCACCCCAACCCCGCGGCGCTCGCCGCACACCTGCGCACCGAACTCCTCGGCGGC
GCCACGGACACCGCCGCCCCGGTGGCCGCGCCCGCCGCCACCGGCGACGACCCGATCGTC
ATCGTCGGCATGGCCTGCCGCTTCCCCGGAGGCGTCAACTCGCCCGAGGACCTCTGGCAG
CTCGTCCTCGACGAGGTGGACGCCGTCGGCGACTTCCCGGCCGACCGCGGCTGGGACCTC
GACGCCCTGGCCGGCGACGGACCGGGCCGCAGCGCCACCGACCAGGGCGGATTCCTCTAC
GACGCCACCGACTTCGACCCCGGTCTGTTCGGTGTCTCGCCGCGCGAGGCCATGGTGATG
GACCCGCAGCAGCGGATCCTGCTCGAGGCGTCCTGGGAGGCCCTGGAGCGGGCCGGCATC
GACCCCGGCACCCTGCGCGGCAGCGGCACCACCGGCGTCTTCGTCGGCGGCGGCTCCGGC
GACTACCGGCCGCCGGCCGAGTACGGCCAGTGGCAGACCGCCCAGTCCGCCAGCCTGCTG
TCCGGCCGCCTCGCCTACACCTTCGGCATCCAGGGCCCCACGGTGTCCGTCGACACCGCC
TGCTCCTCCTCCCTGGTCGCCCTGCACCTGGCCGCCCAGGCCCTGCGCTCCGGCGAGTGC
TCGATCGCCCTGGCCGGCGGTGTCACCGTGATGGCCACCCCGGTCGGCTTCGTCGAGTTC
AGCGCCCAGGGCGCGCTGTCGCCCGACGGCCGCTGCCGCGCCTTCTCCGAGGACGCCAAC
GGCACCGGCTGGTCGGAGGGTGTCGGCATGCTCGTCGTCGAGCGCCTGTCCGACGCCCGC
CGCAACGGCCACCGGGTGCTCGCCGTGCTGCGCGGCTCCGCCATCAACCAGGACGGCGCC
TCCAACGGACTGACCGCGCCCAGCGGCCCCGCCCAGCAGCGCGTCATCCGCCAGGCCCTC
GCCAACGCCCGCCTGGAGGCCGCCGACGTCGACGCCGTCGAGGCGCACGGCACCGGCACC
AAGCTCGGCGACCCGATCGAGGCGCAGGCCCTGCTCGCCACCTACGGGCAGGACCGCGAG
CGGCCCGTGCTCGTCGGCTCGCTGAAGGCCAACATCGGCCACACGCAGGCCGCGTCCGGT
GTCGGCGGCGTCATCAAGATGGTGCTCGCCATGCAGCACGGTCTGCTGCCGCGCTCGCTG
TACACCGAGAACCCCTCCTCGCACGTCGACTGGACCGCGGGCAACGCCCGCCTGCTCACC
GAGCTGACCCCCTGGCCCGAGTCGGAGCGGGTGCGCCGGGCCGCCGTCTCCTCCTTCGGG
GCCAGCGGCACCAACGCCCACCTGATCCTGGAGCAGCCGGAGCCCGTCAGGCAGCCCGTG
GAGGGTGCCCGGCCCGCCGAGGACGGCTCGCCCGTCCCGGTCCTGCTGTCCGGCCGCTCG
CAGAACGCGCTGCGCGCCCAGGCCCGCAAGCTTCTGGCCCATGTGGCGGGACACCCCGAG
GAGACGGTCACCGACCTGGCCCGCACCCTGGCCACCACCCGCGCCGTCTTCGAGCACCGG
GCCGCGGTGACCGCCGCCGACCGGGACGCCCTGATCGCCGGACTCACCGCCGTCGCGGAG
GGCACCACCGCCGCGCACATCGTCGAGCACCAGGTGGAGCGCACCGGCAAGCACGCCGTG
CTCTTCTCCGGACAGGGCTCCCAGCAGCTCGGCATGGGCCGGGACCTGTACGAGCGGTTC
CCGGCGTTCGCCGAGGCGTTCGACGCGGTCCTCGCCCGGCTCGACGGCCACCTCGGCGCC
TCGCTGCGGGACGTCGTCTGGCACGGCGACCAGGAGACCCTGAACGAGACCGGGCACACC
CAGCCCGCGCTGTTCGCCTTCGAGGTCGCCCTGTACCGCCTGGTGGAGTCCTGGGGAGTG
ACGCCGGACTTCGTCGCGGGACACTCCGTCGGCGAGATCGCCGCCGCCCATGTCGCGGGC
GTCCTCTCCCTGGACGACGCCTGCCGGCTGGTCGCCGCACGGGCCCGCCTGATGCAGGAC
CTGCCGCGCGGCGGCGCCATGGTCGCGGTCGAGGCCACCGAGCAGGAGGTCGCCGCCGAA
CTCACCGAGGCGGTGTCGATCGCCGCGGTCAACGGCCCCACCTCCGTGGTGCTCGCCGGT
GCGGAGGACGCGGTGCTCGCCGTGGCCGCCGTCCTCGCCGAGCGTGGCCGCCGCACCTCC
CGCCTCAAGGTCAGCCACGCCTTCCACTCGGTGCTGATGGACCCGATGCTCGCCGAGTTC
CGCAAGGTCGCCGAGAGCCTGCGCTACGAGGCACCCCGCATCGCCGTCGTGTCCAACGTG
ACCGGCGACGTGGCGGGCGCCGACGAACTGTGCGACGCCGACTACTGGGTGCGCCATGTG
CGCGGCACCGTCCGGTTCGCCGACGGCGTCACCGCACTGGCCGGCCGTGGCGTCCGGGTC
CTCCTCGAACTCGGCCCCGACGCGGTGCTGTCCGCGCTGGCCGAGCAGAGCGCCCCGGAC
ACCGTGAGCATCCCCGCGCAGCGCCGCAACCGCGACGAGGTGGAGACCCTGGTCGCCGCC
CTCGGCCGGCTGCACGTACACGCCGCCGGACCCCGCTGGGACGCCTTCTTCGACGCCGCC
CCCGGCTCCTGGCTGGACCTGCCGACCTACGCCTTCCAGCGCGGCCGGTTCTGGCCGGAC
ACCCTGCCCACCGCCCCGCAGGGCGGCGCGACCGCAGGGGAGGCCGACGGCACCGACAGC
GCCTTCTGGGACGCCGTCGCACAGGAGGACTTCGGCTCGCTGGAGTCCGTCCTCGACGTC
GAGGGCGACGCCCTGTCCAAGGTGCTGCCGGCGCTGCTCGACTGGCGTCGCCGCACCTCC
GAGGAGACCCAGCTCGACAGCTGGCGCCACCGCATCGTCTGGAAGCGGCTGACCGGCGCG
GCGATGGCCCACCGCAAGCCGCTCACCGGCACCTGGCTGGCCGTCGTCCCCGAGGGCCTC
GGCGAGGACCCGTGGGTGACGACCGCGCTGGACGCCCTGGGCACCCGGGTGGTGCGCGCC
GAGGTCGGCGCCGACGGCCGGGAGGCCATGGCCGCCACCCTGCGGGAGGCCGCCGGGGAG
GGCACCCGCTTCGGCGGCGTCGTCTCCCTGCTGGCCCTGCGCGAGACCGTGCACGGCGAT
GTGCCGGAGGGCGTCGCCCTCACCGGCACGCTGCTCCAGGCGCTCGGCGACGCCGGGATC
GAGGCCCCGCTGTGGTGCGTCACCCGCAGCGCCGTGTCCGCCAACCGCTCCGACCGTCCG
CGTCGGCCGCTGCAGGCCGCCGTGTGGGGCCTGGGCCGGGTGGCCGCGCTGGAGTACCCG
AACCGCTGGGGCGGTCTGGTGGACCTGCCGGAGCGCGCCGACGAACGGGCCGCCGCCGGA
CTCGCCGCCGTCCTCGCCGGACTCGACGGGGAGGACCAGGTCGCCGTGCGCGGCTCCGCC
GTCCTCGCCCGCCGCCTGGTGCCGGCCCCGGACCGCGGACAGAGCGGCGCCTGGGACCCG
ACCGGCACCGTGCTGATCACCGGCGGCACCGGAGCCATCGGCGCCCATGTGGCCCGCCGA
CTGGCCAAGGACGGCGTCCAGCACCTGGTGCTGCTGAGCCGCCGCGGAGCCGAGGCGCCC
GGCGCCACCGCCCTGCGCGACGAACTCCAGACGCTCGGCGCCGGCGTCACCCTCGCCGCC
TGCGACGCCTCCGACCGGGGCCAGCTGGCCGCGGTGCTGGACGCGATCCCGGACGACCGG
CCGCTGACCGCGGTGCTGCACGCGGCGGGCGTGCTCGACGACGGCGTCATCGACCGGCTC
ACCCCGGAGCGGTACCAGAAGGTGTTCCGCGCGAAGGTGACCTCGGCGCTGCTCCTCGAC
GAGCTGACCCGCGACCTCGACCTGGCCGCGTTCGTCCTGTTCTCGTCCGCCTCCTCCGCG
GTCGGCAACCCCGGCCAGGCCAACTACGCGGCGGCCAACGCGGTCCTGGACGCCCTCGCC
GAGGCCCGCCGGGTGCAGAACCTGCCCGCGACCTCCGTGTCCTGGGGCGCCTGGGGCGGC
GGCGGCATGGCCGACGGCCACGGCGCGGACGACGCGGCCCGCCGGGCCGGCGTCGCCGCC
ATGGACCCGGACCTCGCCGTGGAGTCGCTGCTGCGGCTGGTCACCGGCAAGGAGCCGACC
GCGGTGGTCGCCGAGGTCGACCTCGACCGGTTCGCCTCCGCCTTCGGCGGCGCCCGGCCG
AGCGCCCTGCTGCGGGAGTTCCCCGGCTACCGGGAGACCGTCGCCGCCGCGGCGCCGGCG
TCCCCGGAGGGCACCCTCGCCGACCGGCTGGCGGGCATGGCGCCGGCCCGCCGCCTGGAC
ACCGTCGTGGACCTGGTACGGACCCGTGCCGCGCAGGTCCTCGGCTACCCGGACATCGAC
GCCGTCGGAGCCGAACGGTCCTTCCGGGACCTCGGGGTGGACTCGCTGGGCGCGGTCGAG
CTGCGCAACCAGCTCGGCGCCGAGACCGGTCTGAGCCTGCCCGCGACGCTGGTCTTCGAC
CACCCGACGCCGCTGGCGCTGGGCGAGTTCGTCCTCGCCCGGCTCGCCCCCGAGGAGGCC
GGGCCGGCCGTGTCCGACGAGGAGACCGAGATCAGGGCCGTACTGGCCTCCGTCCCGCTC
GACCGACTGCGTGAGATCGGGGTCCTGGAGCCGCTGCTCCAGCTCGCCGGACGCGGTGGT
GGGGCCGGCGACGACGAAGACGGCGAGTCCGTCGACTCGATGACAGTGGCAGACCTGGTG
CGGGCCGCGCTCAACGGCCAGTCCGACCTGTAG
[9] KS34..396
[9] AT564..880
[9] malonyl-CoA752..756
[9] DH929..1091
[9] KR1402..1578
[9] ACP1679..1749
[10] KS1772..2146
[10] AT2304..2622
[10] malonyl-CoA2492..2496
[10] KR2943..3122
[10] ACP3225..3295
[11] KS3316..3689
[11] AT3851..4171
[11] methylmalonyl-CoA4043..4047
[11] KR4478..4658
[11] ACP4761..4831
[12] KS4854..5229
[12] AT5385..5706
[12] malonyl-CoA5578..5582
[12] KR6018..6197
[12] ACP6299..6369
[13] KS6392..6761
[13] AT6909..7228
[13] malonyl-CoA7099..7103
[13] kr7578..7744
[13] ACP7840..7914
[14] KS7937..8300
[14] AT8461..8768
[14] malonyl-CoA8646..8650
[14] KR9082..9261
[14] ACP9362..9432
[9] KS100..1188
[9] AT1690..2640
[9] malonyl-CoA2254..2268
[9] DH2785..3273
[9] KR4204..4734
[9] ACP5035..5247
[10] KS5314..6438
[10] AT6910..7866
[10] malonyl-CoA7474..7488
[10] KR8827..9366
[10] ACP9673..9885
[11] KS9946..11067
[11] AT11551..12513
[11] methylmalonyl-CoA12127..12141
[11] KR13432..13974
[11] ACP14281..14493
[12] KS14560..15687
[12] AT16153..17118
[12] malonyl-CoA16732..16746
[12] KR18052..18591
[12] ACP18895..19107
[13] KS19174..20283
[13] AT20725..21684
[13] malonyl-CoA21295..21309
[13] kr22732..23232
[13] ACP23518..23742
[14] KS23809..24900
[14] AT25381..26304
[14] malonyl-CoA25936..25950
[14] KR27244..27783
[14] ACP28084..28296

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [553-684]  G3DSA:3.40.366.10 [752-869]  G3DSA:3.40.366.10 [2290-2427]  G3DSA:3.40.366.10 [2492-2610]  G3DSA:3.40.366.10 [3846-3974]  G3DSA:3.40.366.10 [4043-4158]  G3DSA:3.40.366.10 [5378-5510]  G3DSA:3.40.366.10 [5578-5696]  G3DSA:3.40.366.10 [6901-7034]  G3DSA:3.40.366.10 [7099-7217]  G3DSA:3.40.366.10 [8449-8581]  G3DSA:3.40.366.10 [8646-8760]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2943-3109]  2.99999999999998e-58 PF00106 [9082-9246]  1.5e-59 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1707-1722]  PS00012 [3253-3268]  PS00012 [4789-4804]  PS00012 [6327-6342]  PS00012 [7872-7887]  PS00012 [9390-9405]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1672-1788]  5.69999708783953e-28 SSF47336 [3218-3333]  3.69999438558106e-25 SSF47336 [4754-4870]  5.29999657550189e-26 SSF47336 [6292-6408]  3.80000697093586e-28 SSF47336 [7837-7953]  4.40000933643891e-28 SSF47336 [9355-9469]  2.39999798157265e-22 SSF47336
SSF47336   ACP_like
 [1679-1749]  PS50075 [3225-3295]  PS50075 [4761-4831]  PS50075 [6299-6369]  PS50075 [7840-7914]  PS50075 [9362-9432]  PS50075
PS50075   ACP_DOMAIN
 [1678-1752]  1.10000000000001e-125 G3DSA:1.10.1200.10 [3225-3298]  1.10000000000001e-125 G3DSA:1.10.1200.10 [4759-4835]  1.10000000000001e-125 G3DSA:1.10.1200.10 [6298-6372]  1.10000000000001e-125 G3DSA:1.10.1200.10 [7844-7917]  1.10000000000001e-125 G3DSA:1.10.1200.10 [9360-9436]  1.10000000000001e-125 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1683-1748]  6.80000000000001e-11 PF00550 [3228-3294]  1.6e-09 PF00550 [4764-4830]  4.00000000000001e-10 PF00550 [6302-6368]  2.5e-12 PF00550 [7850-7913]  3.1e-12 PF00550 [9365-9431]  1.9e-12 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1402-1577]  1.09999999999999e-63 PF08659 [4478-4657]  4.80000000000003e-59 PF08659 [6018-6196]  1.2e-62 PF08659 [7578-7740]  2.5e-29 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-273]  2.39999999999997e-84 PF00109 [1772-2020]  1.10000000000001e-93 PF00109 [3316-3564]  2.70000000000002e-98 PF00109 [4854-5103]  1.69999999999998e-94 PF00109 [6392-6636]  1.60000000000002e-91 PF00109 [7937-8179]  4.2e-90 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [281-396]  4.10000000000004e-45 PF02801 [2028-2146]  2.70000000000002e-48 PF02801 [3572-3689]  8.30000000000004e-46 PF02801 [5111-5229]  2.89999999999999e-44 PF02801 [6645-6761]  1.99999999999999e-47 PF02801 [8187-8300]  9.9e-45 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [564-880]  3.99999999999998e-65 PF00698 [2304-2622]  4.2e-67 PF00698 [3851-4171]  1.79999999999997e-106 PF00698 [5385-5706]  1e-65 PF00698 [6909-7228]  1.9e-73 PF00698 [8461-8768]  3.70000000000004e-66 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  6.1e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-862]  3.99998544139406e-73 SSF52151 [2299-2586]  1.09999184471405e-69 SSF52151 [3849-4152]  2.80000504261099e-67 SSF52151 [5382-5679]  2.7000136937899e-72 SSF52151 [6906-7208]  2.1000026783403e-72 SSF52151 [8456-8765]  6.00001679190159e-75 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [686-751]  1.60000240695997e-18 SSF55048 [2429-2491]  1.20000117458134e-16 SSF55048 [3977-4042]  1.79999754022375e-18 SSF55048 [5512-5577]  1.20000117458134e-18 SSF55048 [7036-7098]  1.89999859865865e-17 SSF55048 [8583-8645]  1.69999922284049e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-285]  G3DSA:3.40.47.10 [286-452]  G3DSA:3.40.47.10 [1774-2032]  G3DSA:3.40.47.10 [2033-2197]  G3DSA:3.40.47.10 [3319-3576]  G3DSA:3.40.47.10 [3577-3740]  G3DSA:3.40.47.10 [4856-5115]  G3DSA:3.40.47.10 [5116-5281]  G3DSA:3.40.47.10 [6392-6647]  G3DSA:3.40.47.10 [6648-6813]  G3DSA:3.40.47.10 [7939-8191]  G3DSA:3.40.47.10 [8192-8354]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [25-395]  1.19999063421924e-93 SSF53901 [1764-2144]  9.09992432541739e-103 SSF53901 [3309-3688]  9.49996855930963e-104 SSF53901 [4853-5227]  2.80000504261099e-102 SSF53901 [6384-6760]  1.19999063421924e-102 SSF53901 [7929-8299]  2.80000504261099e-99 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1404-1598]  G3DSA:3.40.50.720 [2944-3124]  G3DSA:3.40.50.720 [3198-3218]  G3DSA:3.40.50.720 [4478-4696]  G3DSA:3.40.50.720 [6018-6234]  G3DSA:3.40.50.720 [7577-7739]  G3DSA:3.40.50.720 [9082-9300]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [186-202]  PS00606 [1933-1949]  PS00606 [3477-3493]  PS00606 [5016-5032]  PS00606 [6549-6565]  PS00606 [8092-8108]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-861]  3.60002015031011e-123 SM00827 [2303-2603]  1.09999184471405e-128 SM00827 [3853-4151]  4.30000170645869e-123 SM00827 [5386-5687]  SM00827 [6910-7209]  1.90000694315261e-127 SM00827 [8461-8751]  2.2999842048857e-125 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1680-1752]  8.69997440322062e-34 SM00823 [3226-3298]  2.30000440726534e-32 SM00823 [4762-4834]  3.60000433965927e-29 SM00823 [6300-6372]  1.60000240695997e-34 SM00823 [7845-7917]  1.90000694315261e-33 SM00823 [9363-9435]  1e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [929-1091]  2.39999798157263e-88 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-451]  SM00825 [1774-2198]  SM00825 [3319-3740]  SM00825 [4856-5281]  SM00825 [6394-6814]  SM00825 [7939-8355]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1402-1578]  4.50001022902825e-62 SM00822 [2943-3122]  3.39999972437719e-57 SM00822 [4478-4658]  1.20000117458134e-51 SM00822 [6018-6197]  4.19999771339582e-62 SM00822 [7578-7744]  2.19999900980708e-13 SM00822 [9082-9261]  1.3000049540733e-57 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit