close all open/close all

CDS information : Amph_00070


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction56,829 / 58,019 / + [in whole cluster]
56,829 / 58,019 / + [in contig]
Location56829..58019 [in whole cluster]
56829..58019 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)AmphL
Gene
Gene (GenBank)amphL
EC number
Keyword
  • C-8 hydroxylate
Note
Note (GenBank)
  • probably hydroxylates amphotericin precursor at C8
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
[14700629] Biosynthesis of deoxyamphotericins and deoxyamphoteronolides by engineered strains of Streptomyces nodosus. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>cytochrome P450 [AmphL]
MVNPTPPPSLEDAAPSVLRLSPLLRELQMRAPVTKIRTPAGDEGWLVTRHAELKQLLHDE
RLARAHADPANAPRYVKSPLMDLLIMDDVEAARAAHAELRTLLTPQFSARRVLNMMPMVE
GIAEQILNGFAAQEQPADLRGNFSLPYSLTVLCALIGIPLQEQGQLLAVLGEMATLNDAE
SVARSQAKLFGLLTDLAGRKRAEPGDDVISRLCETVPEDERIGPIAASLLFAGLDSVATH
VDLGVVLFTQYPDQLKEALADEKLMRSGVEEILRAAKAGGSGAALPRYATDDIEIADVTI
RTGDLVLLDFTLVNFDEAVFDDADLFDIRRSPNEHLTFGHGMWHCIGAPLARMMLKTAYT
QLFTRLPGLKLASSVEELQVTSGQLNGGLTELPVTW
selected fasta
>cytochrome P450 [AmphL]
ATGGTCAACCCGACACCGCCGCCCTCTCTCGAGGATGCCGCGCCTTCGGTGCTCCGCCTC
AGCCCGCTGCTGCGCGAGCTCCAGATGCGTGCTCCCGTCACCAAGATCCGCACCCCGGCC
GGCGACGAGGGCTGGCTGGTGACCCGGCACGCCGAGCTGAAGCAGCTGCTGCACGACGAG
CGCCTGGCCCGTGCGCACGCCGACCCGGCCAACGCGCCCCGCTACGTCAAGAGCCCCTTG
ATGGACCTGCTCATCATGGACGACGTGGAGGCGGCCCGCGCCGCGCACGCCGAGCTGCGC
ACCCTGCTCACCCCGCAGTTCTCCGCCCGCCGGGTGCTCAACATGATGCCCATGGTGGAG
GGGATCGCGGAGCAGATCCTGAACGGCTTCGCCGCCCAGGAACAACCCGCCGATCTGCGG
GGCAACTTCTCGCTGCCGTACTCGCTGACCGTGCTGTGCGCCCTGATCGGCATCCCGCTG
CAGGAGCAGGGCCAACTCCTCGCGGTGCTGGGCGAGATGGCCACGCTGAACGACGCGGAG
AGCGTCGCCAGGAGCCAGGCGAAGCTGTTCGGGCTGCTGACCGACCTGGCCGGCCGCAAG
CGGGCCGAACCCGGCGACGACGTGATCTCCCGGCTGTGCGAGACGGTCCCGGAGGACGAG
CGCATCGGCCCCATCGCCGCGAGCCTGCTCTTCGCCGGCCTCGACAGCGTTGCCACCCAT
GTCGACCTGGGCGTCGTGCTGTTCACGCAGTACCCGGACCAGCTGAAGGAGGCACTCGCC
GACGAGAAGCTGATGAGGAGCGGCGTCGAGGAGATCCTGCGGGCCGCGAAGGCCGGCGGC
TCGGGCGCCGCGCTGCCGCGCTACGCCACCGACGACATCGAGATCGCCGACGTCACCATT
CGCACCGGCGACCTGGTGCTGCTCGACTTCACGCTGGTCAACTTCGACGAGGCGGTCTTC
GACGACGCGGACCTCTTCGACATCCGCCGCTCGCCCAACGAGCACCTGACGTTCGGGCAC
GGCATGTGGCACTGCATCGGTGCCCCGCTGGCCCGGATGATGCTGAAGACCGCCTACACG
CAGCTGTTCACCCGGCTGCCCGGTCTGAAGCTGGCCAGCTCGGTGGAGGAGCTCCAGGTG
ACCTCCGGCCAGCTCAACGGCGGCCTCACCGAACTGCCCGTCACCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [19-396]  9.3000000000001e-82 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [263-364]  5.10000000000001e-14 PF00067
PF00067   p450
 [4-396]  8.89993011983204e-70 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [138-154]  1e-33 PR00359 [155-170]  1e-33 PR00359 [191-213]  1e-33 PR00359 [267-278]  1e-33 PR00359 [287-314]  1e-33 PR00359 [315-330]  1e-33 PR00359 [336-345]  1e-33 PR00359 [345-356]  1e-33 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit