close all open/close all

CDS information : Amph_00080


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction58,139 / 58,648 / + [in whole cluster]
58,139 / 58,648 / + [in contig]
Location58139..58648 [in whole cluster]
58139..58648 [in contig]
TypeCDS
Length510 bp (169 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AmphORF1
GeneORF1
Gene (GenBank)amphORF1
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [AmphORF1]
MTSDNRTGPPSFGSEREMLRAFLDYHRATLAMKCEGLTDEELRQRSMPPSTLSLLGLVRH
MAEVERAWFRRVFEDNDAPMVWSDKIDFQAAYDASGSTRQEAFTAWEAEVADSRRIERES
ESLDRVGHQPRWREEVSLRMVMVHVLLEYGRHNGHADLLREGIDGTVGA
selected fasta
>hypothetical protein [AmphORF1]
ATGACCAGCGACAACCGCACAGGACCGCCCAGTTTCGGCAGCGAACGCGAGATGCTGCGG
GCCTTCCTCGACTACCATCGCGCGACCCTCGCCATGAAGTGTGAAGGGCTCACCGACGAG
GAGCTGCGGCAGCGGTCGATGCCGCCGTCCACGCTCTCGCTGCTCGGTCTGGTGCGGCAC
ATGGCGGAGGTGGAGCGTGCCTGGTTCCGCCGGGTGTTCGAGGACAACGACGCGCCCATG
GTCTGGTCCGACAAGATCGACTTCCAGGCCGCGTACGACGCGAGCGGGTCGACCCGACAG
GAGGCGTTCACGGCCTGGGAGGCCGAGGTGGCCGACTCGCGCCGCATCGAGCGCGAGAGC
GAGTCCCTGGACCGGGTCGGCCATCAGCCGAGGTGGCGCGAGGAGGTGTCGCTGCGGATG
GTGATGGTGCACGTCCTCCTGGAATACGGCCGGCACAACGGGCACGCGGACCTTCTGCGT
GAGGGCATCGACGGAACCGTGGGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007061 Protein of unknown function DUF664 (Family)
 [18-165]  3.5e-49 PF04978
PF04978   DUF664
SignalP No significant hit
TMHMM No significant hit