close all open/close all

CDS information : Amph_00090


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction59,610 / 58,756 / - [in whole cluster]
59,610 / 58,756 / - [in contig]
Locationcomplement(58756..59610) [in whole cluster]
complement(58756..59610) [in contig]
TypeCDS
Length855 bp (284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative aminodeoxychorismate lyase
putative 4-amino-4-deoxychorismate lyase
Product (GenBank)AmphORF2
GeneORF2
Gene (GenBank)amphORF2
EC number4.1.3.38
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
Related Reference
ACC
Q6W5R4
NITE
FR008_00020
PmId
[19389784] Functional characterization of the first two actinomycete 4-amino-4-deoxychorismate lyase genes. (Microbiology. , 2009)

close this sectionSequence

selected fasta
>putative aminodeoxychorismate lyase [AmphORF2]
MAAGLGVGEGGVGIDRVEVNGVEADSEDLKVLMRVSYAHFTSMQVRGGAVRGLDLHLRRL
DESARGLFGRGLDAERVRGCVRHALEGGPEAVSVRVTVFSRRLDAVLRGEAVEPELAVAT
SAPAEAQSEPMRLRAVEYERDLPHVKHVGTFGLIHGRRQAVLSGYDDVLFTDRYGRISEA
SVWNIGFYDGERVIWPEAAVLPGITMQLLQRGLEAKGIPSERREVRLDDIVARASGSPVL
AAFLTNSISPALPVASIDGAALAVESAVTDLLVDCYESNPWETV
selected fasta
>putative aminodeoxychorismate lyase [AmphORF2]
ATGGCAGCCGGGCTGGGTGTGGGTGAGGGAGGGGTTGGCATCGACCGGGTGGAAGTCAAC
GGTGTCGAGGCGGACAGCGAGGACCTCAAGGTGCTCATGCGGGTCAGCTACGCGCATTTC
ACCTCGATGCAGGTGCGGGGCGGTGCGGTCCGGGGGCTGGATCTGCACCTGAGACGGTTG
GACGAGAGCGCGCGCGGGTTGTTCGGCAGGGGCCTGGACGCCGAGCGGGTGCGGGGATGT
GTGCGGCACGCCCTCGAAGGGGGCCCGGAGGCGGTATCGGTCCGGGTGACCGTCTTCTCC
CGGAGGCTGGATGCCGTGCTGCGCGGCGAGGCCGTGGAGCCGGAGCTGGCGGTGGCGACG
AGCGCCCCGGCTGAGGCGCAGAGCGAGCCGATGCGACTGCGGGCGGTGGAGTACGAACGG
GACCTGCCTCATGTGAAACACGTGGGGACGTTCGGGCTCATTCATGGCCGACGGCAGGCG
GTGCTCTCCGGGTACGACGACGTACTGTTCACCGATCGGTACGGCCGGATCAGCGAGGCG
TCGGTCTGGAACATCGGCTTCTACGACGGGGAGCGAGTGATCTGGCCGGAGGCCGCGGTG
CTGCCGGGCATCACGATGCAGCTGCTGCAGCGGGGGCTGGAGGCCAAGGGCATCCCCTCA
GAGCGGCGTGAGGTCCGGCTCGATGACATCGTGGCCCGTGCGTCCGGCTCCCCGGTCCTC
GCTGCCTTCCTGACGAACTCGATCTCGCCGGCCCTTCCGGTCGCGAGCATCGACGGGGCA
GCACTGGCCGTCGAATCGGCGGTCACGGACCTGCTCGTGGACTGCTACGAGAGCAATCCC
TGGGAAACCGTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001544 Aminotransferase, class IV (Family)
 [11-277]  1.3000049540733e-33 SSF56752
SSF56752   Aminotrans_IV
 [53-271]  2.5e-23 PF01063
PF01063   Aminotran_4
SignalP
 [1-2]  0.067 Signal
Eukaryota   
 [1-38]  0.039 Signal
Bacteria, Gram-positive   
TMHMM No significant hit