close all open/close all

CDS information : Amph_00100


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction59,869 / 61,470 / + [in whole cluster]
59,869 / 61,470 / + [in contig]
Location59869..61470 [in whole cluster]
59869..61470 [in contig]
TypeCDS
Length1,602 bp (533 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)AmphORF3
GeneORF3
Gene (GenBank)amphORF3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)

close this sectionSequence

selected fasta
>hypothetical protein [AmphORF3]
MNDAGEVVCRPSSKRPLWFFVGLGAAGALLAAGRAAFGGGFLDVGVGVGLLLALVGIAAL
HAVTAQVRADAYGLHSRTLLRRRSVPWRDVADLRVRLKYIKNGGKSRRVGLVLRDGHRRH
LPLPTSVKSHDPDFDAKLEGLRALHRHYGTPESSHIAVVSPGTAGAGWVGSLIACALLLV
SAGVAAVFVPSAGSHMREWKSATPCTAESPVTERGECLTTLPAVIARTDAHQPKQPSWLY
FMDGRPVKRVRVSYEAAEEFQSGDNVELTFWHGQVMKVAGEGHVWREHIAGAGDVAVVAA
VLTLAAGYPAARVLLRLRGRRLPDDEVLPSELPFAGALVGTALWLLPLCYVHPLSLLDSP
VAMTWAAAGSLVSLGLFGWAWHATRIIVPGAIGAIGAIGASEASAGKAGEEASTKKAGEG
EEEVFLVARFLEDTDYNPYGFGTHIALGGGTLAVTPGPGRYGAHRIPVERLIVKGVRRAR
GGDDDTVPASWHIAELDDAGTTVRLAAAPADLARIIRALDSAEASVNSADPKP
selected fasta
>hypothetical protein [AmphORF3]
GTGAACGATGCCGGTGAAGTGGTCTGCCGTCCCTCCAGCAAGCGCCCTCTGTGGTTCTTC
GTCGGACTCGGTGCGGCCGGGGCGCTCCTGGCCGCCGGGCGTGCGGCGTTCGGGGGCGGG
TTCCTGGACGTGGGGGTGGGCGTCGGCCTGCTCCTTGCCCTGGTGGGGATCGCGGCTCTC
CACGCGGTGACCGCCCAGGTGCGCGCCGACGCGTACGGCCTGCACTCCCGGACACTGTTG
CGCCGCCGGAGCGTGCCGTGGCGCGATGTCGCCGACCTGCGCGTACGTCTGAAGTACATA
AAAAACGGAGGGAAGTCCCGTCGCGTCGGCCTGGTGCTGCGCGACGGACACAGGCGGCAC
CTGCCCCTCCCGACGTCCGTGAAGTCCCACGATCCGGACTTCGACGCGAAGCTGGAGGGA
CTCCGCGCGCTCCACCGCCACTACGGAACCCCGGAGTCGAGCCATATCGCCGTCGTCTCT
CCCGGCACCGCCGGGGCCGGCTGGGTCGGGTCGCTGATCGCGTGCGCGCTGCTGCTCGTG
AGCGCGGGCGTGGCGGCGGTATTCGTGCCGAGCGCCGGGTCGCACATGCGGGAGTGGAAG
TCGGCGACCCCGTGCACCGCCGAGAGTCCCGTCACGGAACGTGGCGAATGCCTCACCACC
CTGCCGGCCGTGATCGCGCGGACCGACGCCCACCAGCCCAAGCAGCCGAGCTGGCTGTAC
TTCATGGACGGCCGGCCGGTGAAGCGAGTCCGGGTTTCGTACGAGGCCGCCGAGGAATTC
CAGTCCGGCGACAACGTCGAACTGACCTTCTGGCACGGTCAGGTGATGAAGGTCGCCGGA
GAAGGCCATGTTTGGCGGGAACACATCGCCGGCGCCGGGGACGTGGCGGTCGTCGCTGCC
GTGCTCACCCTCGCCGCGGGCTACCCTGCGGCCCGGGTACTGCTGCGCCTGCGCGGGCGC
CGGCTGCCCGACGACGAGGTCCTTCCGTCGGAACTTCCGTTCGCGGGCGCGCTCGTCGGT
ACGGCCCTGTGGCTGCTGCCGCTCTGCTACGTCCACCCCCTGTCCCTGCTCGACTCCCCC
GTGGCGATGACATGGGCGGCCGCGGGCTCGCTGGTCTCGCTGGGCCTGTTCGGCTGGGCC
TGGCACGCCACTCGGATCATTGTGCCCGGAGCGATCGGAGCGATCGGAGCGATCGGAGCG
TCCGAAGCATCCGCCGGGAAAGCGGGGGAAGAAGCGTCCACCAAGAAGGCGGGGGAAGGG
GAAGAGGAGGTGTTCCTGGTCGCCCGTTTCCTGGAGGACACCGACTACAACCCTTACGGC
TTCGGCACCCACATCGCCCTGGGTGGTGGCACCCTCGCGGTGACGCCCGGCCCGGGCCGG
TACGGAGCGCACCGCATACCGGTGGAACGGCTGATCGTCAAGGGCGTGCGGCGCGCCCGG
GGTGGCGACGACGACACCGTCCCCGCAAGCTGGCACATCGCCGAACTCGACGACGCAGGC
ACGACCGTTCGCCTCGCGGCGGCCCCGGCCGACCTGGCCCGCATCATCCGCGCGTTGGAC
TCCGCGGAGGCCTCCGTGAACTCTGCGGACCCCAAGCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019692 Protein of unknown function DUF2581 (Family)
 [65-146]  3.4e-12 PF10756
PF10756   DUF2581
SignalP
 [1-31]  0.412 Signal
Bacteria, Gram-negative   
 [1-31]  0.436 Signal
Bacteria, Gram-positive   
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [15-37]  Transmembrane (o-i) [44-66]  Transmembrane (i-o) [167-189]  Transmembrane (o-i) [295-317]  Transmembrane (i-o) [332-354]  Transmembrane (o-i) [361-383]  Transmembrane (i-o)
Transmembrane 6