close all open/close all

CDS information : Amph_00110


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction61,995 / 61,798 / - [in whole cluster]
61,995 / 61,798 / - [in contig]
Locationcomplement(61798..61995) [in whole cluster]
complement(61798..61995) [in contig]
TypeCDS
Length198 bp (65 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.5 electron carrier
Productputative ferredoxin
Product (GenBank)AmphM
Gene
Gene (GenBank)amphM
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
Related Reference
ACC
P18324
PmId
[1846297] Ferredoxins from two sulfonylurea herbicide monooxygenase systems in Streptomyces griseolus. (Biochemistry. , 1991)

close this sectionSequence

selected fasta
>putative ferredoxin [AmphM]
MVHVNVDVDRCVGAGQCVLTASDVFDQDDDGLVTVLAQPSDPSTVETVREAAVVCPSMAI
TVVEN
selected fasta
>putative ferredoxin [AmphM]
ATGGTGCACGTCAACGTGGACGTCGATCGCTGCGTCGGTGCCGGACAGTGCGTCCTGACC
GCGTCGGACGTGTTCGACCAGGACGACGACGGCCTGGTGACCGTCCTCGCACAGCCGTCG
GACCCGTCCACGGTGGAGACGGTCCGGGAGGCCGCGGTGGTCTGCCCCTCGATGGCGATC
ACCGTCGTGGAGAACTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001080 3Fe-4S ferredoxin (Family)
 [6-17]  1.19999985703101e-05 PR00352 [17-27]  1.19999985703101e-05 PR00352 [48-60]  1.19999985703101e-05 PR00352
PR00352   3FE4SFRDOXIN
IPR010693 Ferredoxin soy-like (Family)
 [2-65]  1.4e-14 PF06902
PF06902   DUF1271
SignalP No significant hit
TMHMM No significant hit