close all open/close all

CDS information : Amph_00120


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction63,250 / 62,051 / - [in whole cluster]
63,250 / 62,051 / - [in contig]
Locationcomplement(62051..63250) [in whole cluster]
complement(62051..63250) [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)AmphN
Gene
Gene (GenBank)amphN
EC number
Keyword
  • C-16 carboxy group formation
Note
Note (GenBank)
  • probably oxidises C-41 methyl branch in amphotericin precursor
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
[16079135] Biosynthesis of amphotericin derivatives lacking exocyclic carboxyl groups. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>cytochrome P450 [AmphN]
MTAETEMTTFAPGCPVAFPLRRPGRPFPPPEYADYRAGEGLVRSELPASGPVWLVTRHED
VRTVLTDPRISADPSRPGFPRARRTGGAPSQSEIPGWFVALDPPEHDRFRKTLIPEFTVR
KVRELRPAIQQIVDERIDALLAAGNSADLIADFALSVPSLVISDLLGVPKADRDFFEAKT
KVLVTLSSTDEQRDEASKALLRYLNRLIQIKGRRPGEDLISRLLQAGTMNRQELSGVSML
LLIAGHETTANNIGLGVVQLLTNPQWIGDDRIVEEMLRYYSVADLVSFRVAVEDVEIGGQ
LIKAGEGIVPLIAAANHDGSVFDKPEEFNPERSARSHVAFGYGVHQCLGQNLVRVEMEIA
YRTLFERIPTLELAVPVEELPLKYDGVLFGLHELPVTWS
selected fasta
>cytochrome P450 [AmphN]
ATGACCGCCGAGACCGAGATGACGACCTTCGCGCCGGGCTGCCCCGTCGCCTTCCCGCTG
CGCCGGCCGGGACGTCCGTTCCCGCCGCCGGAGTACGCCGACTACCGTGCGGGCGAGGGC
CTGGTCCGCTCCGAACTGCCCGCAAGCGGCCCGGTGTGGCTGGTGACGCGGCACGAGGAC
GTGCGGACCGTGCTGACGGACCCCCGGATCAGCGCGGACCCCTCCCGCCCCGGCTTCCCG
AGGGCCAGGCGCACCGGCGGCGCCCCCTCGCAGTCGGAGATCCCGGGCTGGTTCGTGGCG
CTGGACCCCCCGGAGCACGACCGGTTCCGCAAGACGCTGATCCCGGAGTTCACCGTGCGC
AAGGTGCGGGAGCTGCGTCCGGCGATCCAGCAGATCGTGGACGAGCGGATCGACGCGTTG
CTCGCCGCAGGCAACTCGGCGGACCTGATCGCGGACTTCGCGCTGTCCGTGCCGTCGCTG
GTCATCTCCGACCTGCTCGGGGTGCCCAAGGCGGACCGGGACTTCTTCGAGGCGAAGACA
AAGGTCCTGGTGACCCTCAGCTCCACCGACGAGCAACGTGACGAGGCCTCCAAGGCGCTG
CTGCGTTATCTGAACCGGCTCATCCAGATCAAGGGCCGCCGCCCCGGCGAGGACCTGATC
AGCCGGCTGCTCCAGGCCGGCACCATGAACCGGCAGGAGCTGTCCGGGGTGTCGATGCTC
CTGCTCATCGCGGGGCACGAGACCACGGCGAACAACATCGGCCTGGGCGTCGTCCAGTTG
CTGACCAACCCGCAGTGGATCGGCGACGACCGCATCGTGGAGGAGATGCTGCGGTACTAC
TCGGTCGCCGACCTGGTGTCCTTCCGGGTGGCCGTGGAGGACGTGGAGATCGGCGGCCAG
CTGATCAAGGCCGGTGAGGGCATCGTGCCGCTGATCGCCGCGGCCAATCACGACGGTTCG
GTCTTCGACAAGCCCGAGGAGTTCAACCCGGAGCGTTCCGCGCGCTCGCACGTGGCGTTC
GGGTACGGCGTCCACCAGTGCCTCGGGCAGAACCTGGTGCGGGTGGAGATGGAGATCGCC
TACCGTACCCTGTTCGAGCGCATCCCGACCCTCGAACTGGCGGTGCCGGTCGAGGAGTTG
CCCCTGAAGTACGACGGCGTGCTGTTCGGCCTGCACGAGCTGCCCGTCACATGGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [244-261]  3.1999989904635e-08 PR00385 [271-282]  3.1999989904635e-08 PR00385 [338-347]  3.1999989904635e-08 PR00385 [347-358]  3.1999989904635e-08 PR00385
PR00385   P450
 [23-398]  2.50000000000001e-99 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [15-398]  9.09992432541739e-93 SSF48264
SSF48264   Cytochrome_P450
 [271-367]  1.69999999999999e-21 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [101-112]  1.20000117458134e-48 PR00359 [148-164]  1.20000117458134e-48 PR00359 [165-180]  1.20000117458134e-48 PR00359 [202-224]  1.20000117458134e-48 PR00359 [289-316]  1.20000117458134e-48 PR00359 [317-332]  1.20000117458134e-48 PR00359 [338-347]  1.20000117458134e-48 PR00359 [347-358]  1.20000117458134e-48 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [340-349]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-33]  0.317 Signal
Bacteria, Gram-positive   
 [1-33]  0.159 Signal
Bacteria, Gram-negative   
TMHMM No significant hit