close all open/close all

CDS information : Amph_00130


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction64,308 / 63,250 / - [in whole cluster]
64,308 / 63,250 / - [in contig]
Locationcomplement(63250..64308) [in whole cluster]
complement(63250..64308) [in contig]
TypeCDS
Length1,059 bp (352 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase
Product (GenBank)AmphDII
Gene
Gene (GenBank)amphDII
EC number2.6.1.-
Keyword
  • mycosamine
Note
Note (GenBank)
  • probable mycosamine biosynthesis protein
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
[16079135] Biosynthesis of amphotericin derivatives lacking exocyclic carboxyl groups. (J Biol Chem. , 2005)

close this sectionSequence

selected fasta
>GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [AmphDII]
MSYTYPVSMPWLKGRELEYVTEAVSGGWISSQGPYVRQFEEAFAAYNDMPHGVACSSGTT
ALTLALRALGVGPGDEVIVPEFTMIATAWAVTYTGATPVFVDCGDDLNIDVSRIEEKITP
RTKVIMPVHIYGRQCDMDAIMNLAYEYNLRVVEDSAEAHGVRPVGDIACFSLFANKIITA
GEGGVCVTRDAHLAEQMAHLRAMAFTKDHSFLHKKLAYNYRMTNMQAAVALAQTEQLDTI
LATRRDIEKRYDEALRDVPGITLMPARDVLWMYDLRAERSEELRAYLADQGVETRVFFKP
MSRQPGYYDANWPSLNASRFSEDGFYLPTHTGLTAQDQEFITDRVRAFYGVL
selected fasta
>GDP-3-keto-6-deoxy-D-mannose C-3 aminotransferase [AmphDII]
ATGTCCTATACGTATCCGGTCTCCATGCCGTGGCTGAAGGGCCGCGAGCTGGAGTATGTG
ACGGAGGCCGTCAGCGGCGGCTGGATCTCGTCGCAGGGCCCCTACGTCCGGCAGTTCGAG
GAGGCGTTCGCCGCCTACAACGACATGCCGCACGGTGTCGCCTGTTCCTCGGGCACCACC
GCGCTGACGCTGGCGCTGCGGGCGCTGGGCGTCGGCCCCGGCGACGAGGTGATCGTCCCG
GAGTTCACCATGATCGCGACCGCCTGGGCGGTCACCTACACGGGGGCGACCCCGGTGTTC
GTGGACTGCGGCGACGACCTGAACATCGATGTCTCCCGCATCGAGGAGAAGATCACCCCG
CGCACCAAGGTGATCATGCCGGTGCACATCTACGGCCGGCAGTGCGACATGGACGCCATC
ATGAACCTGGCGTACGAGTACAACCTGCGGGTCGTCGAGGACTCGGCGGAGGCGCACGGG
GTGCGGCCGGTGGGCGACATCGCCTGCTTCTCGCTGTTCGCCAACAAGATCATCACGGCG
GGTGAGGGCGGGGTGTGCGTGACCCGGGACGCCCATCTGGCCGAGCAGATGGCGCATCTG
CGGGCCATGGCGTTCACCAAGGACCACAGCTTCCTGCACAAGAAGCTGGCCTACAACTAC
CGCATGACCAACATGCAGGCCGCGGTGGCGCTCGCGCAGACCGAGCAGCTGGACACCATC
CTCGCGACCCGCCGCGACATCGAGAAGCGCTACGACGAGGCGCTGCGGGACGTGCCCGGC
ATCACGCTGATGCCGGCCCGCGACGTGCTGTGGATGTACGACCTGCGGGCCGAGCGCAGC
GAGGAGCTGCGCGCGTACCTGGCCGACCAGGGCGTCGAGACCCGGGTGTTCTTCAAGCCG
ATGAGCCGTCAGCCGGGCTACTACGACGCGAACTGGCCGTCGCTGAACGCCTCCCGGTTC
AGCGAGGACGGGTTCTATCTGCCGACGCACACCGGGCTGACCGCGCAGGACCAGGAGTTC
ATCACCGACCGGGTACGCGCCTTCTACGGAGTCCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-352]  4.30000170645869e-91 PIRSF000390
PIRSF000390   PLP_StrS
 [11-346]  8.1e-105 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [5-233]  1.39999999999997e-79 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [237-349]  4.40000000000001e-19 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [2-352]  5.79999653854781e-104 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit