close all open/close all

CDS information : Amph_00140


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction65,775 / 64,324 / - [in whole cluster]
65,775 / 64,324 / - [in contig]
Locationcomplement(64324..65775) [in whole cluster]
complement(64324..65775) [in contig]
TypeCDS
Length1,452 bp (483 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductGDP-mycosamine glycosyltransferase
Product (GenBank)AmphDI
Gene
Gene (GenBank)amphDI
EC number
Keyword
  • mycosamine
Note
Note (GenBank)
  • probably glycosylates amphotericin aglycone with mycosamine
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
[18798210] The in vitro characterization of polyene glycosyltransferases AmphDI and NysDI. (Chembiochem. , 2008)
[20189107] Redesign of polyene macrolide glycosylation: engineered biosynthesis of 19-(O)-perosaminyl-amphoteronolide B. (Chem Biol. , 2010)
[23324745] In vivo investigation of the substrate recognition capability and activity affecting amino acid residues of glycosyltransferase FscMI in the biosynthesis of candicidin. (Mol Biosyst. , 2013)

close this sectionSequence

selected fasta
>GDP-mycosamine glycosyltransferase [AmphDI]
MGGREACGPARSATFRRVLSMGAHRRPILFVSYAESGLLNPLLVLAEELSRRGVEDLWFA
TDEKARDQIESASADSELQFASLGDTVSQMSAVTWDDETYAEVTQRSRFKAHRAVIRHSF
APETRVEKYRALEKAVEEIQPALMVIESMCQFGYELAITKGIPFVLGVPFLPSNVLTSHV
PFAKSYTPSGFPVPHSGLPGKMSLAQRVENELFRVRTLGMFMTKEIREIVEEDNRVRGEL
GISPEARQMMARIDHAEQVLCYSVAELDYPFPMHEKVRLVGTLVPPLPQAPDDEGLSDWL
TEQKSVVFMGFGTITRLTREQVASLVEVARRLEGEGHQVLWKLPSEQQHLLPPAEELPAN
LRIESWVPSQLDVLAHPNVKVFFTHAGGNGYHEGLYFGKPLVVRPLWVDCDDQAVRGQDF
GVSLTVDRPETVDTDDVLDKITRVLNESSFTERAEYYAGLLKAAGGRTAAADLLLGLPVL
AND
selected fasta
>GDP-mycosamine glycosyltransferase [AmphDI]
GTGGGTGGACGCGAGGCGTGCGGGCCTGCGCGGTCCGCCACTTTCCGGAGGGTGTTGTCC
ATGGGCGCGCACAGGCGGCCGATCCTGTTCGTCAGTTATGCCGAAAGCGGTCTTCTCAAT
CCGCTGCTCGTACTGGCCGAGGAATTGTCCCGGCGTGGTGTGGAGGATCTGTGGTTCGCC
ACGGACGAGAAGGCGCGGGACCAGATCGAGTCGGCGTCGGCGGACAGTGAGCTGCAGTTC
GCCTCGCTCGGTGACACCGTGTCGCAGATGTCGGCGGTCACCTGGGACGACGAGACCTAT
GCCGAGGTGACGCAGCGCTCCCGCTTCAAGGCGCACCGCGCGGTCATCCGGCACTCCTTC
GCGCCCGAGACCCGGGTGGAGAAGTACCGGGCGCTGGAGAAGGCCGTCGAGGAGATCCAG
CCCGCCCTGATGGTGATCGAGAGCATGTGCCAGTTCGGGTACGAGCTGGCGATCACCAAG
GGGATCCCGTTCGTGCTCGGGGTGCCGTTCCTGCCGAGCAATGTACTGACCTCGCATGTG
CCGTTCGCCAAGTCGTACACGCCGTCCGGGTTCCCGGTGCCGCACTCGGGCCTGCCCGGC
AAGATGTCGCTCGCCCAGCGGGTGGAGAACGAGCTGTTCCGGGTGCGCACGCTCGGGATG
TTCATGACGAAGGAGATCCGGGAGATCGTCGAGGAGGACAACCGGGTCCGCGGCGAGCTG
GGCATCTCCCCCGAGGCGCGGCAGATGATGGCGCGCATCGACCACGCCGAGCAGGTGCTG
TGCTACTCGGTGGCGGAGCTGGACTACCCGTTCCCGATGCACGAGAAGGTACGGCTGGTG
GGCACGCTGGTGCCGCCGCTGCCGCAGGCGCCGGACGACGAGGGCCTCTCGGACTGGCTG
ACGGAGCAGAAGTCCGTGGTCTTCATGGGCTTCGGCACCATCACCCGGCTCACCCGGGAG
CAGGTCGCCTCGCTGGTGGAGGTGGCCCGCCGCCTCGAGGGCGAGGGCCACCAGGTGCTG
TGGAAGCTGCCGAGCGAGCAGCAGCATCTGCTGCCCCCGGCCGAGGAACTGCCCGCGAAC
CTGCGGATCGAGAGCTGGGTGCCCTCACAGCTGGACGTGCTGGCGCACCCGAACGTCAAG
GTGTTCTTCACGCACGCCGGCGGCAACGGCTACCACGAGGGCCTGTACTTCGGAAAGCCT
CTGGTGGTACGGCCGTTGTGGGTGGACTGCGACGACCAGGCCGTGCGCGGCCAGGACTTC
GGCGTGAGCCTGACCGTCGACCGTCCCGAGACCGTGGACACGGACGACGTCCTCGACAAG
ATCACCCGCGTGCTGAACGAGTCCTCCTTCACCGAACGCGCCGAGTACTACGCCGGGTTG
CTGAAGGCCGCGGGTGGTCGTACCGCCGCCGCGGACCTGCTGCTCGGCCTCCCCGTCCTG
GCAAACGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [109-453]  8.59999999999999e-29 PF00201
PF00201   UDPGT
SignalP
 [1-46]  0.531 Signal
Eukaryota   
 [1-33]  0.338 Signal
Bacteria, Gram-positive   
TMHMM No significant hit