close all open/close all

CDS information : Amph_00160


close this sectionLocation

Organism
StrainATCC 14899 (=NBRC 12895)
Entry nameAmphotericin B
Contig
Start / Stop / Direction70,366 / 79,938 / + [in whole cluster]
70,366 / 79,938 / + [in contig]
Location70366..79938 [in whole cluster]
70366..79938 [in contig]
TypeCDS
Length9,573 bp (3,190 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)AmphB
Gene
Gene (GenBank)amphB
EC number
Keyword
Note
Note (GenBank)
  • polyketide synthase multienzyme polypeptide housing extension modules 1 and 2
Reference
ACC
PmId
[11451671] Amphotericin biosynthesis in Streptomyces nodosus: deductions from analysis of polyketide synthase and late genes. (Chem Biol. , 2001)
[20696392] Structural and functional analysis of A-type ketoreductases from the amphotericin modular polyketide synthase. (Structure. , 2010)
[25835227] Molecular dynamics studies of modular polyketide synthase ketoreductase stereospecificity. (Biochemistry. , 2015)
[26568113] Substrate structure-activity relationships guide rational engineering of modular polyketide synthase ketoreductases. (Chem Commun (Camb). , 2016)
[26976746] Alteration of Polyketide Stereochemistry from anti to syn by a Ketoreductase Domain Exchange in a Type I Modular Polyketide Synthase Subunit. (Biochemistry. , 2016)

close this sectionPKS/NRPS Module

1 methylmalonyl-CoA
2 methylmalonyl-CoA
not conserved YASHS(S->G)
KS38..409
AT573..893
KR1197..1377
ACP1481..1551
KS1578..1952
AT2112..2435
KR2747..2927
ACP3033..3103

close this sectionSequence

selected fasta
>polyketide synthase [AmphB]
MPEPQQNQQEKVVDYLRRVTNDLRRARRRIGELESRDNEPVAIVGMSCRLPGGVSSPESL
WELVESGGDAISGFPADRGWDIEALTGKGEGSSSTHEGGFLYEATDFDAGFFGISPREAT
AMDPQQRLLLEVSWEALERAGIAPTSLRSSATGVFVGSYHWGAPSADTATELHGHALTGT
AASVLSGRLSYVYGLEGPAVTVDTACSSSLVALHMAAQSLRNGESSLALVGGVTILAEPS
VFVEFSAQGGLAQDGRCKAFSDSADGTGWSEGAAVLVVERLSDARRAGHRVLAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRQALANAGLRPGDVDAVEAHGTGTPLGDPIEAQALIATY
GSDRDPQQPLLLGSVKSNIGHTQSAAGVAGLVKMVMAMHNGTLPRTLHLTEPSTHVDWSL
GAVRLLTEETAWPETGRVRRAAVSSFGISGTNAHAVLEQAPVPAEDAEDAGTEDAPQQPA
TVPGALPWLLSAHSGQALCDQAAALVTRLDADPEPRPQDIGQGLLTSRALLERRAVVVGT
GRDELLTGSRALAEGQSWNGLAEGTADVDGRTVFVFPGQGSQWVGMGARLLDESPVFAER
IAECAAALAEFTDWDLLDVLRGAEGAPTLERVDVVQPASFAVMVSLAAVWRAQGVEPDAV
VGHSQGEIAAAVVSGALSLRDGARVVALRSQAIGRTLAGRGGMMSVALPVADVEARLEAF
GGRVSVAAENGPRSCVVSGEPGALDELSELLTAEGVRVRRVPVDYASHSHHVEDLHDEIL
QLLAEVAPKASEVPLFSTVTGDWLDTTVMDAGYWFRSLRGRVLFADAIRGLLDTEHRAFI
EVSSHPVLAMSVQDMIDDAGVVGVASGTLRRDNGGLDRFLLSAAQVFVRGVQVDWAPLFE
GTGATRVDLPTYAFQHERYWNDRAVVDRSASAPMDAEFWAAVEQADVSALTEALGTDEES
VAAILPGLASWRRTRGERSTVDSWRYRVVWEPLAQIPRATLDGTWLLVSAGGVDDDVAEV
LEAGGAEVRRLVLDETCTDPAVLREHLTDTDGLTGIVSVLADAEEGCVRHPGLTLGLALS
VSLAQALGEADVTAPLWFLTCGAFSTGPSDTVTRPLQSQIAGLGWTVAVEHPHRWGGGVD
LPEALDARAAQRLVAALAGALGDDDQLAVRPAGVLARRIVRASGDTRRKARSWKPRGTTL
VTGGSGTLAPGLARHLAAQGAEHLVLLSRRGADAPGAAELAAELQAAGTEVRFAACDITD
PDAVAALLADLKAEGRTVRTVVHTAAVIELAALADTTVDAFADVVHAKVTGARILDELLD
DEELDDFVLYSSTAGMWGSGVHAAYVAGNAYLSALAEQRRARGARATSIHWGKWPDDLER
ELADPHQIRRSGLEYLDPELAMTALTRVMEDDETVIGLMDIDWGTYHDVFTAGRPSHLFD
RIPEVARLLADRAAPAATAVATSGLAARLQGVSAAEQDRIVLSVVREETAAVLGHASAET
VPERRAFRDIGFDSVTAVDLRNRLVAATGLTLPSTMVFDHPNAVALATFLKATALGTTGT
AGDRPTAAVTAGADDDLIVIVGMSCRFPGGANTPEELLRLALDGADVISEFPADRGWDAH
GLYDPDPDRQGRTYSVHGGFLHEAAGFDAGFFGISPREALAMDPQQRLLLETSWEVLERA
GIDPESLHSTATGAFFGASYQDYSSSVQNGTEGAEVHMMTGTAASVLSGRISYLLGLEGP
AVTVDTACSSSLVAMHLACQSLRSGESSLALAGGAAVMATPHAFIGFSRQRALAENGRCK
PFAEGADGMTLAEGVGVVLLEKLSDARRNGHRVLAVVRGSALNQDGASNGLTAPNGLSQQ
RVIRQALANAGLGTADIDVVEAHGTGTKLGDPIEAGALLATYGQGRDGGQPLLLGSVKSN
IGHTQAAAGVAGVIKMVMAMHAGELPGTLHIDEPSSHVDWTSGAVTLLRERTEWPAVGDR
PRRAGISSFGISGTNAHLLLEQAPPAEEPAEEPAGDIEGAPLVPWLLSARSAQALREQAS
RLLTATTGTDVTVEPARVGHALATTRTAFDHRAVVLGSRPEDFTRGLEAVVSSASAPGVV
TGTAGPDSTGPVFVYPGQGSQWWGMGRELLAGSEVFRTAVDDCAAALAPYTDWSLHEVLA
GEGDPELLERVDVVQPALFSMMVALTALWRSHGVEPAAVVGHSQGEIAAAHVAGALSLED
AALVVALRSQALPQLSGLGGMMSVSAPAARVTELLQPWGEALSIAAVNGPSSVIVSGDAD
ALDELLETCREQNVRARKVSVDYASHGRHVEAVRDELARVLAPVSPRTPEVPFYSTVTGA
RLDEAAFDGTYWYTNLRQTVLMEDATRALIASGHRVFVEISPHPVLAAPIQETQESVQEE
LTETGAVLGTLRRDDGDRRRFLTSLAEAHTHGIAVDWTTAFDRPAYAAVDLPTYPFQRQD
FWPEPKTAAPAGTADASDAAFWELVQNQDLDALAGELGIPADDGAARLGDVLPALSAWRT
RSLTRSRADALRYHIEWNRVAEPGTARPAGRLLAVISPDHAGAPWVTAVLDALGPDTVRF
EAKGTDRAAWAAQLAQLREDEGEFHAVVSLLAAAEALHTDHGSVPLGLAQTLLLAQALGD
AGLTAPLWCLTRGGVAAGRGDVLSSPVQGALWGLGRVIGLEHPDRWGGLIDLPETVDTRA
AARLTGLLADAGGEDQLAIRGSGVLARRLAHAAPAVPGSGKRPPVHGSVLVTGGTGGIGG
RVARRLAEQGAAHLVLTSRRGADAPGAAELRAELEQLGVRVTIAACDAADREALAALLAE
LPEDAPLTAVFHSAGVAHDDAPVADLTLGQLDALMRAKLTAARHLHELTADLDLDAFVLF
SSGAAVWGSGGQPGYAAANAYLDALAEHRRSLGLTASSVAWGTWGEVGMATDPEVHDRLV
RQGVLAMEPEHALGALDQMLENDDTAAAITLMDWEMFAPAFTANRPSALLSTVPEAVSAL
SDEGPADGGADAAVPPLRARLDGLPTAERARALVEAVRAEASATLGHDSPDAVPASRAFR
DVGFDSVTAVELRNRLRAALGLPLPAALVFDYPTPTALAQHIGSLLYGTAPDEADTGRAD
DPDARIREALATVPIGRLRKAGLLDMVLKLAESDDTEDSATATDDAADALDLDDMDAEAL
LRLAAENSAN
selected fasta
>polyketide synthase [AmphB]
ATGCCGGAACCCCAGCAGAACCAGCAGGAAAAAGTTGTCGACTACCTTCGCCGGGTCACC
AACGATCTGCGACGCGCCCGCCGCCGGATAGGCGAGCTGGAATCCCGCGACAACGAGCCC
GTCGCGATCGTCGGAATGAGCTGCCGGCTGCCCGGCGGAGTGAGTTCCCCGGAATCCCTG
TGGGAACTCGTGGAATCCGGCGGGGACGCCATCTCCGGATTTCCCGCCGACCGCGGCTGG
GACATCGAGGCGCTCACCGGAAAGGGCGAGGGAAGCAGCTCCACCCACGAGGGCGGATTC
CTCTACGAGGCCACCGACTTCGATGCCGGGTTCTTCGGCATATCGCCCCGCGAGGCGACC
GCCATGGACCCGCAGCAGCGCCTGCTGCTCGAAGTCTCCTGGGAGGCCCTGGAGCGGGCC
GGCATCGCCCCCACCTCCCTGCGCTCCAGCGCGACCGGCGTCTTCGTGGGCTCCTACCAC
TGGGGCGCACCCTCCGCGGACACCGCGACCGAACTCCACGGCCACGCCCTGACCGGCACG
GCCGCCAGCGTGCTGTCCGGCCGGCTCTCCTATGTCTACGGTCTCGAGGGCCCGGCCGTC
ACCGTCGACACCGCGTGCTCCTCCTCCCTCGTCGCCCTGCACATGGCGGCCCAGTCGCTG
CGCAACGGGGAGTCCTCGCTCGCCCTCGTCGGCGGTGTCACCATCCTCGCCGAGCCCTCC
GTCTTCGTGGAGTTCAGCGCCCAGGGCGGTCTCGCCCAGGACGGACGCTGCAAGGCGTTC
TCCGACTCCGCCGACGGCACCGGCTGGTCCGAGGGCGCGGCGGTGCTCGTCGTGGAGCGC
CTCTCCGACGCCCGCCGCGCCGGACACCGGGTGCTCGCCGTGGTGCGTGGCTCCGCGGTG
AACCAGGACGGTGCCTCCAACGGCCTGACCGCCCCCAACGGCCCCTCCCAGCAGCGGGTC
ATCCGGCAGGCACTGGCCAACGCCGGTCTGCGTCCCGGCGATGTCGACGCCGTCGAGGCA
CATGGCACCGGCACACCGCTCGGTGACCCGATCGAGGCCCAGGCCCTGATCGCCACCTAC
GGCTCCGACCGTGACCCGCAGCAGCCGCTGCTGCTGGGCTCGGTGAAGTCCAACATTGGC
CACACCCAGTCCGCGGCCGGTGTCGCCGGACTCGTCAAGATGGTCATGGCGATGCACAAC
GGCACGCTCCCGCGCACCCTGCACCTCACCGAGCCGTCCACGCACGTCGACTGGTCCCTG
GGCGCCGTCCGGCTGCTCACCGAGGAGACGGCCTGGCCGGAGACCGGCCGGGTCCGCCGC
GCCGCCGTGTCCTCCTTCGGCATCAGCGGCACCAACGCCCACGCCGTCCTCGAGCAGGCC
CCCGTGCCCGCCGAGGACGCCGAGGACGCCGGGACCGAGGACGCCCCGCAGCAGCCGGCC
ACCGTGCCGGGCGCCCTGCCGTGGCTGCTCTCCGCCCACTCCGGGCAGGCGCTTTGCGAC
CAGGCCGCCGCCCTCGTCACCCGCCTCGACGCCGACCCCGAGCCGCGCCCCCAGGACATC
GGCCAGGGCCTGCTGACCTCCCGGGCCCTGCTGGAGCGCCGGGCCGTCGTCGTCGGCACC
GGCCGCGACGAACTGCTCACCGGCAGCCGCGCGCTGGCCGAGGGCCAGTCCTGGAACGGA
CTCGCCGAGGGCACCGCCGACGTCGACGGCCGGACCGTCTTCGTCTTCCCCGGTCAGGGC
TCCCAGTGGGTGGGCATGGGTGCCCGACTCCTGGACGAATCACCGGTGTTCGCGGAGCGC
ATCGCCGAGTGCGCCGCCGCGCTCGCCGAGTTCACCGACTGGGACCTGCTCGACGTCCTG
CGGGGTGCCGAGGGTGCTCCGACGCTGGAGCGCGTCGATGTCGTCCAGCCCGCGTCGTTC
GCGGTGATGGTGTCCCTGGCCGCCGTGTGGCGTGCGCAGGGTGTGGAGCCTGACGCGGTG
GTCGGCCACTCGCAGGGTGAGATCGCCGCCGCGGTGGTCTCCGGCGCCCTGTCGCTGCGT
GACGGTGCCCGGGTGGTGGCGCTGCGCAGCCAGGCCATCGGCCGGACGCTGGCCGGGCGG
GGCGGGATGATGTCGGTGGCGCTGCCGGTCGCCGATGTGGAGGCCCGTCTTGAGGCGTTT
GGCGGACGGGTGTCCGTCGCCGCCGAGAACGGCCCCCGCTCCTGTGTGGTCTCCGGCGAA
CCCGGCGCCCTGGACGAGCTGTCCGAACTGCTCACCGCCGAGGGCGTGCGGGTGCGCCGC
GTCCCCGTGGACTACGCCTCGCACTCCCACCATGTCGAGGACCTGCACGACGAGATCCTC
CAGCTGCTGGCCGAGGTCGCGCCCAAGGCGTCCGAGGTTCCGCTGTTCTCCACGGTCACC
GGTGACTGGCTGGACACCACCGTCATGGACGCCGGCTACTGGTTCCGCAGCCTGCGCGGC
CGGGTGCTGTTCGCGGACGCCATCCGCGGTCTGCTCGACACCGAGCACCGTGCCTTCATC
GAGGTCAGCTCCCACCCGGTGCTCGCCATGTCCGTCCAGGACATGATCGACGACGCCGGA
GTGGTCGGCGTGGCCTCCGGCACCCTGCGCCGTGACAACGGCGGCCTCGACCGCTTCCTG
CTGTCCGCCGCCCAGGTGTTCGTGCGCGGCGTCCAGGTCGACTGGGCCCCGCTGTTCGAG
GGCACCGGCGCGACCCGGGTCGACCTGCCCACCTACGCCTTCCAGCACGAGCGGTACTGG
AACGACCGTGCCGTCGTGGACCGTTCGGCCTCCGCGCCGATGGACGCCGAGTTCTGGGCG
GCCGTCGAGCAGGCGGACGTCTCCGCCCTCACCGAGGCGCTCGGCACCGACGAGGAGTCC
GTCGCCGCGATCCTGCCCGGCCTCGCCTCCTGGCGCCGCACCCGCGGCGAGCGCTCCACC
GTCGACTCCTGGCGCTACCGGGTCGTCTGGGAGCCGCTGGCCCAGATCCCCCGCGCCACC
CTGGACGGCACCTGGCTGCTGGTGTCCGCAGGCGGCGTCGACGACGACGTCGCCGAGGTG
CTGGAGGCGGGCGGCGCCGAGGTGCGCCGTCTCGTCCTCGACGAGACCTGCACCGACCCC
GCCGTCCTGCGCGAGCACCTCACGGACACGGACGGCCTCACCGGCATCGTCTCCGTCCTC
GCCGACGCCGAGGAGGGCTGCGTCCGCCACCCCGGACTCACCCTCGGACTCGCCCTGTCG
GTGTCGCTGGCACAGGCACTCGGCGAGGCCGACGTCACCGCCCCGCTGTGGTTCCTGACC
TGCGGCGCCTTCTCCACCGGCCCGTCCGACACCGTCACCCGGCCGCTCCAGAGCCAGATC
GCCGGTCTCGGCTGGACCGTCGCCGTCGAACACCCCCACCGCTGGGGCGGCGGCGTCGAC
CTGCCCGAGGCGCTGGACGCCCGCGCCGCCCAGCGGCTCGTCGCCGCCCTCGCCGGCGCG
CTCGGCGACGACGACCAGCTCGCCGTGCGGCCCGCCGGTGTCCTCGCCCGCCGTATCGTC
CGCGCGAGCGGCGACACCCGCCGCAAGGCCCGCTCCTGGAAGCCGCGCGGCACCACCCTG
GTCACCGGCGGCTCCGGCACCCTCGCCCCCGGACTCGCCCGCCACCTGGCCGCCCAGGGC
GCCGAGCACCTGGTGCTGCTCAGCCGCCGTGGCGCCGACGCCCCCGGCGCGGCCGAACTC
GCCGCCGAACTCCAGGCGGCGGGCACCGAGGTGCGGTTCGCGGCCTGCGACATCACCGAC
CCCGACGCGGTCGCCGCCCTGCTCGCCGACCTGAAGGCCGAGGGCCGCACCGTCCGCACG
GTCGTGCACACCGCCGCCGTCATCGAGCTGGCCGCCCTCGCCGACACCACCGTCGACGCG
TTCGCCGACGTGGTGCACGCCAAGGTGACCGGCGCCCGGATCCTCGACGAACTCCTCGAC
GACGAGGAGCTGGACGACTTCGTCCTGTACTCCTCCACCGCCGGCATGTGGGGCAGCGGC
GTGCACGCCGCGTATGTCGCGGGCAACGCCTATCTGTCCGCGCTCGCCGAACAGCGCCGC
GCCCGCGGCGCCCGCGCCACCTCCATCCACTGGGGCAAGTGGCCCGACGACCTCGAACGC
GAGCTGGCCGACCCGCACCAGATCCGCCGCAGCGGCCTGGAGTACCTCGACCCGGAGCTG
GCGATGACCGCCCTGACCCGGGTCATGGAGGACGACGAGACCGTCATCGGTCTGATGGAC
ATCGACTGGGGCACGTACCACGACGTCTTCACCGCCGGACGGCCCTCGCACCTGTTCGAC
CGGATCCCCGAGGTGGCGCGGCTGCTGGCCGACCGGGCCGCGCCCGCCGCGACGGCCGTT
GCCACCAGCGGCCTGGCCGCCCGCCTCCAGGGCGTGTCCGCCGCCGAGCAGGACCGGATC
GTGCTCTCCGTGGTCCGCGAGGAGACCGCCGCAGTCCTCGGCCACGCCTCCGCCGAGACC
GTCCCGGAACGCCGCGCCTTCCGCGACATCGGCTTCGACTCGGTGACCGCCGTCGACCTG
CGCAACCGCCTGGTCGCCGCGACCGGGCTCACCCTGCCGTCCACCATGGTCTTCGACCAC
CCCAACGCCGTCGCGCTCGCCACGTTCCTGAAGGCCACCGCGCTCGGCACCACCGGCACG
GCCGGCGACCGGCCCACCGCCGCGGTCACCGCGGGCGCCGACGACGACCTGATCGTCATC
GTCGGCATGAGCTGCCGCTTCCCCGGCGGCGCGAACACCCCGGAGGAGCTGCTGCGGCTC
GCCCTCGACGGCGCCGACGTCATCTCCGAGTTCCCCGCCGACCGCGGCTGGGACGCCCAC
GGCCTCTACGACCCGGACCCCGACCGGCAGGGCCGCACCTACTCCGTGCACGGTGGCTTC
CTGCACGAGGCGGCCGGCTTCGACGCCGGGTTCTTCGGCATCTCGCCCCGCGAGGCGCTG
GCCATGGACCCGCAGCAGCGGCTGCTCCTGGAGACCTCCTGGGAGGTCCTGGAGCGGGCC
GGCATCGACCCCGAGTCGCTGCACTCCACCGCCACCGGCGCCTTCTTCGGCGCCAGCTAC
CAGGACTACTCCAGCAGCGTGCAGAACGGCACCGAGGGCGCCGAGGTGCACATGATGACC
GGCACCGCGGCCAGCGTGCTGTCCGGCCGGATCTCCTATCTGCTGGGCCTCGAGGGCCCC
GCGGTCACCGTCGACACCGCCTGCTCCTCCTCCCTGGTCGCGATGCACCTGGCCTGCCAG
TCGCTGCGCAGCGGCGAGAGCAGCCTCGCGCTGGCCGGCGGCGCGGCCGTCATGGCCACC
CCGCACGCGTTCATCGGGTTCAGCCGGCAGCGCGCACTGGCCGAGAACGGCCGCTGCAAG
CCGTTCGCCGAGGGCGCCGACGGCATGACCCTCGCCGAGGGCGTCGGCGTCGTCCTGTTG
GAGAAGCTCTCCGACGCCCGCCGCAACGGCCACCGCGTCCTCGCCGTCGTCCGGGGCTCC
GCCCTCAACCAGGACGGCGCCTCCAACGGCCTGACCGCCCCCAACGGCCTCTCCCAGCAG
CGCGTCATCCGTCAGGCCCTCGCCAACGCCGGACTCGGCACCGCCGACATCGACGTGGTC
GAGGCGCACGGCACCGGCACCAAGCTCGGCGACCCCATCGAGGCCGGCGCCCTGCTCGCC
ACCTACGGCCAGGGCCGCGACGGCGGACAGCCGCTGCTGCTGGGCTCGGTGAAGTCCAAC
ATCGGCCACACCCAGGCCGCCGCGGGCGTCGCCGGTGTCATCAAGATGGTGATGGCCATG
CACGCCGGTGAACTGCCCGGCACCCTGCACATCGACGAGCCCTCCAGCCATGTCGACTGG
ACCTCCGGCGCCGTCACCCTGCTGCGCGAGCGCACCGAGTGGCCCGCCGTGGGGGACCGC
CCCCGCCGGGCCGGCATCTCCTCCTTCGGCATCAGCGGCACCAACGCCCACCTCCTCCTG
GAGCAGGCCCCGCCCGCCGAGGAGCCCGCCGAAGAACCCGCCGGTGACATCGAGGGCGCC
CCGCTCGTCCCCTGGCTGCTGTCCGCCAGGTCCGCGCAGGCGCTGCGCGAGCAGGCGTCC
CGGCTGCTGACCGCGACCACCGGCACCGACGTCACCGTCGAGCCCGCCCGCGTCGGACAC
GCCCTGGCCACCACCAGGACCGCCTTCGACCACCGCGCCGTCGTCCTCGGCAGCCGGCCC
GAGGACTTCACCCGCGGCCTGGAGGCCGTGGTGTCCTCCGCGTCCGCCCCCGGCGTCGTC
ACCGGCACCGCCGGACCGGACTCCACGGGACCCGTCTTCGTGTACCCGGGCCAGGGCTCC
CAGTGGTGGGGGATGGGCCGCGAACTCCTCGCCGGCTCCGAGGTGTTCCGCACCGCCGTC
GACGACTGCGCCGCGGCGCTCGCCCCGTACACCGACTGGTCGCTGCACGAGGTGCTGGCC
GGCGAGGGCGACCCGGAGCTCCTGGAGCGCGTGGACGTCGTCCAGCCCGCCCTGTTCTCG
ATGATGGTCGCGCTCACCGCGCTGTGGCGGTCGCACGGCGTCGAACCGGCCGCCGTCGTC
GGCCACTCGCAGGGCGAGATCGCCGCCGCCCATGTCGCCGGGGCGCTCAGCCTGGAGGAC
GCCGCCCTCGTCGTGGCGCTGCGCAGCCAGGCCCTGCCCCAGCTGTCCGGGCTCGGCGGC
ATGATGTCCGTCTCCGCGCCCGCCGCACGCGTCACCGAACTCCTTCAGCCCTGGGGCGAG
GCGCTGTCCATCGCCGCCGTCAACGGCCCCTCCTCGGTGATCGTCTCCGGCGACGCCGAC
GCCCTCGACGAACTCCTGGAGACCTGCCGCGAGCAGAACGTACGGGCCCGCAAGGTGTCC
GTGGACTACGCCTCGCACGGCCGGCACGTCGAGGCCGTGCGCGACGAACTCGCCCGCGTC
CTCGCCCCCGTCAGCCCCCGCACCCCCGAGGTGCCGTTCTACTCGACCGTCACCGGCGCC
CGGCTCGACGAGGCGGCCTTCGACGGCACCTACTGGTACACCAACCTGCGGCAGACGGTG
CTGATGGAGGACGCCACCCGCGCCCTCATCGCCTCCGGACACCGGGTGTTCGTGGAGATC
AGCCCGCACCCGGTGCTGGCGGCCCCGATCCAGGAGACACAGGAGAGCGTTCAGGAGGAG
CTGACCGAGACCGGCGCCGTCCTCGGCACGCTGCGCCGCGACGACGGCGACCGCCGCCGG
TTCCTCACCTCGCTCGCCGAGGCGCACACCCATGGCATCGCCGTCGACTGGACCACCGCC
TTCGACCGCCCCGCGTACGCGGCCGTCGACCTGCCGACCTACCCCTTCCAGCGGCAGGAC
TTCTGGCCCGAGCCGAAGACCGCCGCCCCCGCGGGCACCGCCGACGCCTCCGACGCCGCC
TTCTGGGAACTGGTCCAGAACCAGGACCTCGACGCGCTCGCCGGTGAACTCGGCATCCCC
GCCGACGACGGCGCCGCCCGGCTCGGCGACGTACTGCCCGCGCTGTCCGCCTGGCGCACC
CGCTCCCTCACCCGCTCCCGGGCGGACGCCCTGCGCTACCACATCGAGTGGAACCGCGTC
GCCGAACCCGGCACCGCCCGGCCCGCCGGCCGGCTGCTCGCGGTGATCTCGCCGGACCAC
GCGGGCGCCCCCTGGGTCACCGCCGTCCTCGACGCGCTCGGCCCGGACACCGTCCGCTTC
GAGGCCAAGGGCACCGACCGGGCCGCCTGGGCCGCGCAGCTCGCCCAGCTCCGCGAGGAC
GAGGGGGAGTTCCACGCCGTGGTCTCGCTGCTCGCCGCCGCCGAGGCACTCCACACCGAC
CACGGTTCGGTGCCTCTCGGCCTCGCCCAGACCCTCCTCCTCGCCCAGGCCCTCGGCGAC
GCGGGACTCACCGCGCCCCTGTGGTGCCTGACCCGGGGCGGTGTCGCCGCCGGCCGCGGC
GATGTCCTCAGCAGCCCCGTGCAGGGTGCGCTGTGGGGCCTCGGCCGGGTCATCGGCCTC
GAACACCCCGACCGGTGGGGCGGTCTGATCGACCTGCCGGAGACGGTCGACACCCGGGCC
GCCGCCCGGCTCACCGGACTGCTCGCCGACGCGGGCGGCGAGGACCAGCTCGCGATCCGC
GGTTCGGGCGTGCTGGCCCGCCGCCTCGCCCACGCCGCCCCGGCCGTACCCGGCTCCGGG
AAGCGCCCGCCGGTCCACGGCTCCGTCCTCGTCACCGGTGGCACCGGCGGCATCGGCGGC
CGGGTCGCCCGCCGCCTCGCCGAACAGGGCGCCGCACACCTGGTGCTGACCAGCCGGCGC
GGCGCCGACGCCCCGGGCGCCGCCGAACTCCGCGCCGAACTGGAGCAGCTGGGCGTCCGG
GTGACCATCGCCGCCTGCGACGCCGCCGACCGGGAGGCGCTCGCCGCGCTCCTGGCCGAG
CTGCCCGAGGACGCGCCGCTCACCGCGGTCTTCCACTCCGCCGGTGTGGCCCACGACGAC
GCCCCCGTCGCCGACCTGACGCTCGGTCAGCTCGACGCGCTCATGCGCGCCAAGCTGACC
GCCGCCCGGCATCTGCACGAGCTGACCGCCGACCTCGACCTGGACGCGTTCGTGCTGTTC
TCGTCCGGCGCCGCGGTCTGGGGCAGCGGTGGCCAGCCCGGCTACGCCGCCGCCAACGCC
TACCTCGACGCCCTCGCCGAGCACCGCAGGTCCCTCGGCCTGACCGCCTCGTCGGTGGCC
TGGGGCACCTGGGGCGAGGTCGGCATGGCGACCGACCCCGAGGTCCACGACCGGCTCGTC
CGCCAGGGCGTGCTGGCCATGGAACCGGAACACGCCCTGGGCGCCCTCGACCAGATGCTC
GAGAACGACGACACCGCGGCCGCCATCACCCTGATGGACTGGGAGATGTTCGCGCCCGCC
TTCACCGCGAACCGGCCCAGCGCCCTGCTGAGCACCGTCCCGGAGGCCGTCTCGGCGCTC
AGCGACGAGGGCCCGGCCGACGGTGGCGCCGACGCGGCCGTGCCGCCGCTGCGCGCCCGC
CTGGACGGGCTGCCCACCGCCGAGCGCGCCCGTGCCCTCGTCGAGGCCGTCCGCGCCGAG
GCGTCCGCGACCCTCGGCCACGACAGCCCCGACGCGGTGCCCGCCTCGCGCGCCTTCCGC
GACGTCGGCTTCGACTCCGTCACCGCCGTCGAACTGCGCAACCGGCTCCGCGCCGCCCTC
GGGCTGCCCCTGCCGGCCGCCCTGGTCTTCGACTACCCGACCCCCACGGCCCTCGCCCAG
CACATCGGTTCGCTGCTCTACGGCACCGCACCCGATGAGGCGGACACCGGCCGCGCCGAC
GACCCCGATGCCCGTATCCGCGAGGCCCTCGCCACCGTCCCGATCGGACGGCTGCGCAAG
GCGGGCCTCCTCGACATGGTTCTGAAACTCGCCGAGTCCGACGACACCGAGGACAGCGCC
ACCGCGACGGACGACGCGGCGGACGCCCTCGACCTCGACGACATGGACGCCGAAGCCCTG
CTGCGGCTGGCCGCCGAGAACTCGGCGAACTGA
[1] KS38..409
[1] AT573..893
[1] methylmalonyl-CoA765..769
[1] KR1197..1377
[1] ACP1481..1551
[2] KS1578..1952
[2] AT2112..2435
[2] methylmalonyl-CoA not conserved YASHS(S->G)2303..2307
[2] KR2747..2927
[2] ACP3033..3103
[1] KS112..1227
[1] AT1717..2679
[1] methylmalonyl-CoA2293..2307
[1] KR3589..4131
[1] ACP4441..4653
[2] KS4732..5856
[2] AT6334..7305
[2] methylmalonyl-CoA not conserved YASHS(S->G)6907..6921
[2] KR8239..8781
[2] ACP9097..9309

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [568-696]  G3DSA:3.40.366.10 [765-880]  G3DSA:3.40.366.10 [2103-2235]  G3DSA:3.40.366.10 [2303-2424]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1197-1364]  2.29999999999998e-51 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1509-1524]  PS00012 [3061-3076]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1484-1550]  7.3e-08 PF00550 [3036-3102]  3.2e-11 PF00550
PF00550   PP-binding
 [1474-1592]  1.99999636034521e-21 SSF47336 [3025-3120]  5.00000909915354e-22 SSF47336
SSF47336   ACP_like
 [1481-1551]  PS50075 [3033-3103]  PS50075
PS50075   ACP_DOMAIN
 [1482-1553]  5.10000000000004e-37 G3DSA:1.10.1200.10 [3032-3106]  5.10000000000004e-37 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2747-2926]  8.39999999999997e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-284]  1.39999999999997e-89 PF00109 [1578-1826]  8.49999999999995e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-409]  2.59999999999998e-49 PF02801 [1834-1952]  4.10000000000004e-46 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [573-893]  1.39999999999997e-105 PF00698 [2112-2435]  1.29999999999998e-110 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [9-32]  2.1e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [571-874]  3.39999972437719e-67 SSF52151 [2110-2412]  6.19996040581186e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [699-764]  3.00000067992871e-19 SSF55048 [2237-2302]  6.09999977126211e-18 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-296]  G3DSA:3.40.47.10 [297-461]  9.69999999999989e-127 G3DSA:3.40.47.10 [1578-1838]  G3DSA:3.40.47.10 [1839-2006]  9.69999999999989e-127 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [31-408]  3.30001976117415e-101 SSF53901 [1568-1950]  1.69998802370953e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1197-1411]  5.80000000000004e-69 G3DSA:3.40.50.720 [2749-2969]  5.80000000000004e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1739-1755]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [575-873]  5.39997012872478e-121 SM00827 [2114-2415]  2.1000026783403e-124 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1482-1554]  2.800005042611e-27 SM00823 [3034-3106]  5.79999653854781e-32 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [41-462]  SM00825 [1578-2005]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1197-1377]  9.49996855930963e-45 SM00822 [2747-2927]  1.90000694315261e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit