close all open/close all
first first   Ansam_00020 Ansam_00020

CDS information : Ansam_00010


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction975 / 94 / - [in whole cluster]
81,772 / 82,653 / + [in contig]
Locationcomplement(94..975) [in whole cluster]
81772..82653 [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Productpolyketide synthase enoylreductase domain protein
Product (GenBank)quinone oxidoreductase
Gene
Gene (GenBank)asm1
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Family/Domain
FD
IPR020843

close this sectionSequence

selected fasta
>polyketide synthase enoylreductase domain protein [quinone oxidoreductase]
MKKISYSEHGGPDVLRLVDADEPSAGPGQVRIAVRAAGVNPFDWRVREGQFPVPLPAGTG
RDAAGVVDRVGAGVDGVAVGDRVFGEGIETCAEFAVLTAWAHLPEGLSFEEAAGYPSVVE
TALRVLREVGVREGQSLLVSGASGGVGSAVLQIARDRGVRVVGTASAANQDYLRDLGATA
TTYGPGWVERVRALVPVDAALDLAGAGVLPDLVALTGDPRKVITIADRAAAEHGVRFSGA
AHDVPAALAEAVDLITRGALRIPVERAYPLAETARAHADSQAGHARGRRVIVI
selected fasta
>polyketide synthase enoylreductase domain protein [quinone oxidoreductase]
ATGAAGAAGATCAGCTACAGCGAGCACGGCGGTCCGGACGTGCTGCGCCTGGTGGACGCC
GACGAGCCGAGCGCCGGGCCGGGGCAGGTGCGGATCGCGGTGCGCGCGGCGGGGGTGAAC
CCGTTCGACTGGCGGGTGCGCGAGGGGCAGTTCCCGGTGCCGCTGCCCGCCGGGACCGGG
CGGGACGCGGCCGGGGTGGTGGACCGGGTCGGCGCGGGGGTCGACGGGGTCGCGGTCGGC
GACCGGGTGTTCGGCGAGGGGATCGAGACCTGCGCGGAGTTCGCGGTGCTGACGGCGTGG
GCCCACCTCCCCGAGGGCCTCTCGTTCGAGGAGGCGGCCGGGTACCCGTCGGTGGTGGAG
ACGGCGCTGCGGGTGCTGCGTGAGGTCGGGGTGCGGGAGGGGCAGTCGCTGCTGGTCAGC
GGCGCGTCCGGGGGTGTCGGGTCGGCGGTGCTCCAGATCGCGCGCGACCGGGGCGTGCGG
GTGGTCGGGACCGCGAGCGCGGCGAACCAGGACTACCTGCGCGACCTGGGCGCGACCGCG
ACGACCTACGGGCCGGGGTGGGTCGAGCGGGTGCGGGCGCTGGTCCCGGTGGACGCGGCG
CTCGACCTGGCCGGGGCGGGGGTGCTCCCCGACCTGGTCGCGCTGACCGGCGACCCGCGG
AAGGTGATCACCATCGCCGACCGGGCCGCCGCCGAGCACGGCGTCCGGTTCTCCGGCGCG
GCGCACGACGTGCCCGCCGCGCTGGCCGAGGCGGTCGACCTGATCACGAGGGGCGCCCTG
CGCATCCCGGTCGAACGCGCCTACCCGCTCGCCGAGACGGCGCGGGCCCACGCCGACAGC
CAGGCCGGGCACGCGCGGGGGCGACGGGTGATCGTGATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [134-155]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR011032 GroES-like (Domain)
 [1-141]  3.3e-33 SSF50129
SSF50129   GroES-like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [27-93]  1.5e-11 PF08240
PF08240   ADH_N
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [10-291]  8.8e-13 SM00829
SM00829   Enoylreductase
SignalP No significant hit
TMHMM No significant hit
first first   Ansam_00020 Ansam_00020