close all open/close all

CDS information : Ansam_00020


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction1,046 / 1,690 / + [in whole cluster]
81,701 / 81,057 / - [in contig]
Location1046..1690 [in whole cluster]
complement(81057..81701) [in contig]
TypeCDS
Length645 bp (214 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional regulator
Product (GenBank)transcriptional repressor
Gene
Gene (GenBank)asm2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
[19609582] Constitutive overexpression of asm2 and asm39 increases AP-3 production in the actinomycete Actinosynnema pretiosum. (J Ind Microbiol Biotechnol. , 2009)

close this sectionSequence

selected fasta
>TetR family transcriptional regulator [transcriptional repressor]
MTAPPGRRERKKAATRQKIADTALRLFLERGYDAVGVRDVAAEADVAVTTVFAHFDSKEA
LVFERDADFEHRLVRAVAERGRDDLVPALRHEVHAIVRHCTTDRSAALGELIQSSPDLRG
YNEAMCARHAASLATAIAAELGLPPRTTACRAIARFAVDAHVLAREAQDPEAAVDEVFRM
IQAAWDAADLSADPHADPHADPHADLSAGAPQDR
selected fasta
>TetR family transcriptional regulator [transcriptional repressor]
GTGACCGCGCCACCGGGCCGTCGCGAGCGCAAGAAGGCCGCGACCCGTCAGAAGATCGCC
GACACCGCCCTGCGCCTGTTCCTGGAGCGCGGCTACGACGCGGTCGGCGTCCGCGACGTC
GCGGCCGAGGCCGACGTCGCCGTCACCACGGTCTTCGCGCACTTCGACAGCAAGGAGGCC
CTGGTCTTCGAGCGCGACGCCGACTTCGAGCACCGCCTCGTCCGGGCCGTCGCCGAGCGC
GGGCGGGACGACCTCGTCCCCGCACTGCGCCACGAGGTTCACGCGATCGTGCGGCACTGC
ACCACCGACAGGTCGGCCGCGCTGGGGGAGTTGATCCAGTCCTCACCGGACCTGCGCGGC
TACAACGAGGCCATGTGCGCCCGCCACGCCGCCTCCCTCGCGACCGCCATCGCCGCCGAA
CTCGGCCTGCCGCCGCGCACCACGGCCTGCCGGGCGATCGCCCGCTTCGCGGTCGACGCC
CACGTCCTCGCGCGCGAGGCCCAGGACCCCGAGGCGGCCGTGGACGAGGTCTTCCGGATG
ATCCAGGCCGCCTGGGACGCCGCCGACCTCAGCGCCGACCCCCACGCCGACCCCCACGCC
GATCCCCACGCCGACCTCAGCGCGGGCGCGCCGCAGGACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [19-32]  2.79999889404114e-08 PR00455 [40-63]  2.79999889404114e-08 PR00455
PR00455   HTHTETR
 [13-73]  PS50977
PS50977   HTH_TETR_2
 [19-63]  5e-16 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [4-84]  1.50000306971104e-17 SSF46689
SSF46689   Homeodomain_like
 [4-59]  1.9e-19 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [60-182]  1.1e-14 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit