close all open/close all

CDS information : Ansam_00030


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction1,858 / 2,124 / + [in whole cluster]
80,889 / 80,623 / - [in contig]
Location1858..2124 [in whole cluster]
complement(80623..80889) [in contig]
TypeCDS
Length267 bp (88 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)asm3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MPFVAPLLLGLLTVPVARRVAKPLARGVVRTSAGIVAGARRAAHAVGEELQDITAEVTAE
LEAARLAADVVEPPRGAPAGTGPDARAR
selected fasta
>hypothetical protein [unknown]
ATGCCCTTCGTCGCTCCTCTCCTGCTCGGTCTCCTGACCGTCCCCGTGGCCAGGAGGGTC
GCCAAGCCGCTCGCCCGCGGCGTCGTCCGGACCTCCGCGGGCATCGTCGCCGGTGCCCGC
CGCGCCGCGCACGCCGTCGGCGAGGAGCTCCAGGACATCACCGCCGAGGTGACCGCCGAG
CTGGAGGCCGCCCGGCTCGCCGCCGACGTGGTGGAGCCCCCGAGGGGCGCGCCCGCCGGG
ACCGGGCCGGACGCCAGAGCGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-21]  0.991 Signal
Eukaryota   
 [1-42]  0.448 Signal
Bacteria, Gram-positive   
TMHMM No significant hit