close all open/close all

CDS information : Ansam_00040


close this sectionLocation

Organism
StrainATCC 31565
Entry nameAnsamitocin
Contig
Start / Stop / Direction2,165 / 4,411 / + [in whole cluster]
80,582 / 78,336 / - [in contig]
Location2165..4411 [in whole cluster]
complement(78336..80582) [in contig]
TypeCDS
Length2,247 bp (748 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding/permease protein
Product (GenBank)ABC transporter
Gene
Gene (GenBank)asm4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12060743] The biosynthetic gene cluster of the maytansinoid antitumor agent ansamitocin from Actinosynnema pretiosum. (Proc Natl Acad Sci U S A. , 2002)
Related Reference
ACC
Q9L4X6
NITE
Nysta_00020
PmId
[16251298] Nystatin biosynthesis and transport: nysH and nysG genes encoding a putative ABC transporter system in Streptomyces noursei ATCC 11455 are required for efficient conversion of 10-deoxynystatin to nystatin. (Antimicrob Agents Chemother. , 2005)
Family/Domain
FD
IPR001140
FD
IPR003593, IPR003439

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding/permease protein [ABC transporter]
MTQLLDAAPTTRLTGFRVRSVVPGRQRWDVPRVRRNPRAARALEAALLRQPGITGAQASP
ATGRVLVLHDRALGVAEVGAALRDAVAAAASAPLVVEGSTTTSPPATAASTSGGTSEVAL
RPASAVLRRPLALVGVVTGVSSAVLRHAWRALLRPLRRTAAGTRLSAHPLVRALGRRRSA
LAAAAALTVACQLAELGLGLFLGWILLVLIKGEYAPLTALGVTSAPAQLLALAAGAAATC
GVVVVLSAASGARWRALGQGVRRDQRARLHRHTQRLEMRHIQRERPSRVAGVLADDVDQL
GAFFSGPAGEAVQLATSALILVPSFLVLVPGIAWIAFLPLPFVAALSLRQRDRSAADYAS
AGEQAALLRSRLSAALEAAATVKSACAEDHEAELVDLLELAGADAATRTQQHAVRFGEGI
RAWTTCSMAGTLLVGGLKVLDGTLPFERFSPLIGLPQQMVMRLTRLGPIVDQYQRTLAAH
DRVEHLMSLPTEPTGGRALARERVAGAIALDRVSFSYEGRPRVLDRLSLRAAAGRVTGIV
GATGSGKTTVAKLLMRFQDADTGRVLLDGRDVRGLRLPDLRAAVGFVAQDPFLFDGTIAD
NIRYGTFSATDEQVREAARTAEAHAFVESLPLGYDTVVGEHGAALSGGQRQRIALARTVL
KNPPVVVLDEATSAVDNETEAAIQRALATFARGRTLIVIAHRLSTVRNADHIYVLERGGV
VEQGAHEGLVASGGRYASLWELQAGARG
selected fasta
>putative ABC transporter ATP-binding/permease protein [ABC transporter]
GTGACCCAGCTCCTCGACGCCGCCCCGACCACCAGGCTCACCGGGTTCCGGGTGCGCTCG
GTCGTCCCCGGCCGCCAGCGCTGGGACGTCCCGCGCGTGCGCAGGAACCCGCGCGCCGCG
CGCGCCCTCGAAGCCGCGCTGCTCCGCCAGCCCGGCATCACCGGGGCGCAGGCCAGCCCC
GCGACCGGCCGGGTGCTGGTGCTGCACGACCGGGCGCTCGGCGTCGCCGAGGTCGGCGCC
GCCCTGCGGGACGCGGTCGCCGCCGCGGCCAGCGCCCCGCTGGTCGTCGAGGGCAGCACC
ACGACGAGCCCACCGGCCACCGCCGCGAGCACGTCCGGCGGCACGTCCGAGGTCGCGCTC
CGGCCCGCGAGCGCCGTCCTGCGCCGCCCGCTCGCCCTGGTCGGCGTGGTCACCGGCGTC
TCGTCCGCCGTCCTGCGCCACGCCTGGCGCGCCCTCCTGCGGCCCCTGCGCCGCACCGCC
GCGGGCACCCGGCTCTCCGCCCACCCGCTGGTGCGCGCCCTCGGCCGCCGCCGGTCGGCG
CTCGCCGCCGCCGCCGCGCTGACGGTGGCCTGCCAGCTCGCCGAGCTCGGCCTCGGGCTG
TTCCTCGGCTGGATCCTGCTGGTGCTGATCAAGGGCGAGTACGCCCCGCTCACCGCGCTG
GGCGTCACGAGCGCCCCCGCCCAGCTGCTCGCGCTCGCCGCCGGGGCCGCCGCGACCTGC
GGGGTCGTCGTCGTGCTCTCCGCCGCCTCCGGCGCCCGCTGGCGCGCGCTCGGCCAGGGC
GTCCGGCGCGACCAGCGCGCCCGCCTGCACCGCCACACCCAGCGCCTGGAGATGCGGCAC
ATCCAGCGCGAGCGGCCCAGCCGCGTCGCGGGCGTGCTCGCCGACGACGTCGACCAGCTC
GGCGCGTTCTTCTCCGGCCCGGCGGGCGAGGCGGTCCAGCTCGCCACCAGCGCGCTGATC
CTGGTCCCGTCGTTCCTGGTGCTCGTGCCCGGCATCGCCTGGATCGCGTTCCTGCCCCTG
CCGTTCGTCGCGGCCCTGTCCCTGCGCCAGCGCGACCGCTCCGCCGCCGACTACGCCAGC
GCGGGCGAGCAGGCCGCCCTGCTGCGCAGCAGGCTCTCCGCCGCACTGGAGGCCGCCGCC
ACGGTCAAGAGCGCCTGCGCCGAGGACCACGAGGCCGAGCTGGTCGACCTGCTGGAGCTG
GCGGGCGCCGACGCGGCCACGCGCACCCAGCAGCACGCCGTCCGGTTCGGCGAGGGCATC
CGCGCCTGGACCACCTGCTCCATGGCGGGCACCCTGCTCGTGGGCGGGCTCAAGGTGCTC
GACGGCACGCTCCCGTTCGAGCGGTTCAGCCCGCTGATCGGGCTGCCGCAGCAGATGGTC
ATGCGGCTGACCCGGCTGGGCCCGATCGTCGACCAGTACCAGCGCACCCTCGCCGCGCAC
GACCGGGTCGAGCACCTGATGTCCCTGCCCACCGAGCCCACCGGTGGCCGCGCGCTGGCC
CGCGAGCGGGTCGCGGGCGCCATCGCGCTCGACCGCGTGTCCTTCTCCTACGAGGGCCGC
CCGCGCGTGCTGGACCGGTTGTCGCTGCGCGCGGCGGCGGGCCGGGTCACCGGCATCGTC
GGCGCGACCGGCTCGGGCAAGACCACCGTCGCCAAGCTGCTGATGCGCTTCCAGGACGCG
GACACCGGCCGGGTGCTGCTCGACGGGCGGGACGTGCGCGGCCTGCGCCTGCCCGACCTG
CGCGCGGCCGTCGGGTTCGTCGCCCAGGACCCGTTCCTGTTCGACGGCACGATCGCGGAC
AACATCCGCTACGGCACGTTCTCCGCCACCGACGAGCAGGTCCGCGAGGCCGCCCGCACG
GCCGAGGCCCACGCGTTCGTCGAGTCGCTGCCCCTGGGCTACGACACGGTGGTCGGCGAG
CACGGCGCGGCGCTGTCCGGCGGGCAGCGGCAGCGGATCGCGCTCGCCAGGACCGTGCTG
AAGAACCCGCCCGTGGTGGTCCTGGACGAGGCCACGTCGGCGGTGGACAACGAGACCGAG
GCGGCGATCCAGCGCGCGCTGGCGACGTTCGCGCGGGGCCGCACCCTGATCGTGATCGCG
CACCGGCTCTCCACCGTCCGCAACGCGGACCACATCTACGTGCTGGAGCGGGGCGGCGTC
GTCGAGCAGGGCGCGCACGAGGGCCTGGTGGCCTCCGGCGGGCGCTACGCCTCGCTGTGG
GAGCTCCAGGCGGGGGCGAGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001140 ABC transporter, transmembrane domain (Domain)
 [207-462]  2.1e-06 PF00664
PF00664   ABC_membrane
IPR003439 ABC transporter-like (Domain)
 [508-742]  PS50893
PS50893   ABC_TRANSPORTER_2
 [548-673]  6.1e-21 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [533-719]  3.89999861795218e-18 SM00382
SM00382   AAA
IPR011527 ABC transporter, transmembrane domain, type 1 (Domain)
 [169-493]  7.0999832511256e-38 SSF90123
SSF90123   ABC_TM_1
IPR017871 ABC transporter, conserved site (Conserved_site)
 [645-659]  PS00211
PS00211   ABC_TRANSPORTER_1
IPR017940 ABC transporter, integral membrane type 1 (Domain)
 [182-475]  PS50929
PS50929   ABC_TM1F
SignalP No significant hit
TMHMM
 [185-207]  Transmembrane (i-o) [227-249]  Transmembrane (o-i) [318-340]  Transmembrane (i-o)
Transmembrane 3